PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PDK_30s744781g001

Organism

Phoenix dactylifera

Taxonomic ID

42345

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix

Family

M-type_MADS

Protein Properties

Length: 109aa MW: 12146 Da PI: 11.4327

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PDK_30s744781g001	genome	PDK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	85	4.4e-27	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrng+lKKA+EL +LCdaev +++fsstg+ly+++s PDK_30s744781g001 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGLMVFSSTGRLYDFAS 59 8***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	6.2E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.469	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.83E-27	2	64	IPR002100	Transcription factor, MADS-box
CDD	cd00265	8.89E-37	2	60	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-28	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.3E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.6E-28	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 109 aa Download sequence Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGLMVFSS TGRLYDFAST 60 RYGFVQGRET TNDGTERGSG AGKYNLKLPS KDKRRRINPS HIQLGIGKV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	6e-19	1	60	1	60	MEF2C
5f28_B	6e-19	1	60	1	60	MEF2C
5f28_C	6e-19	1	60	1	60	MEF2C
5f28_D	6e-19	1	60	1	60	MEF2C
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	92	96	KRRRI

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269\|PubMed:23463009}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU746383	9e-78	EU746383.1 Nypa fruticans microsatellite Nyf02 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_026663469.1	2e-35	MADS-box transcription factor 23-like isoform X3
Swissprot	Q6Z6W2	1e-33	MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBL	A0A200QI41	3e-35	A0A200QI41_9MAGN; Transcription factor
TrEMBL	A0A251RHG8	2e-35	A0A251RHG8_PRUPE; Uncharacterized protein
STRING	Gorai.009G227500.1	5e-35	(Gossypium raimondii)
STRING	evm.model.supercontig_177.14	6e-35	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G57230.1	3e-34	AGAMOUS-like 16

Publications ? help Back to Top
Guo S, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14. Nat Commun, 2013. 4: p. 1566 [PMID:23463009] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876] Wang H, et al. A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway. Plant Physiol., 2016. 170(4): p. 2365-77 [PMID:26858364]