PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s679881g007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MYB
Protein Properties Length: 355aa    MW: 38890.3 Da    PI: 4.7378
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s679881g007genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33e-171663148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd +l  +++++G g+W++ +++ g+ R++k+c++rw +yl
  PDK_30s679881g007 16 KGSWTPEEDMRLMAYIQKYGHGNWRALPKKAGLLRCGKSCRLRWINYL 63
                       799*****************************99************97 PP

2Myb_DNA-binding51.62.2e-1669114148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg++T eE+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  PDK_30s679881g007  69 RGNFTREEEETIIKLHGLLGNK-WSKIASCLP-GRTDNEIKNVWNTHL 114
                        89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-25766IPR009057Homeodomain-like
PROSITE profilePS5129415.9721163IPR017930Myb domain
SuperFamilySSF466894.49E-3113110IPR009057Homeodomain-like
SMARTSM007171.7E-131565IPR001005SANT/Myb domain
PfamPF002499.8E-161663IPR001005SANT/Myb domain
CDDcd001671.19E-101863No hitNo description
PROSITE profilePS5129424.79464118IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2667118IPR009057Homeodomain-like
SMARTSM007171.3E-1468116IPR001005SANT/Myb domain
PfamPF002491.6E-1469114IPR001005SANT/Myb domain
CDDcd001671.78E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MGRGRAPCCE KVGLNKGSWT PEEDMRLMAY IQKYGHGNWR ALPKKAGLLR CGKSCRLRWI  60
NYLRPDIKRG NFTREEEETI IKLHGLLGNK WSKIASCLPG RTDNEIKNVW NTHLKKRLLH  120
RGQSQQTDKL GETPSSSSST PTHSSSDQGE GKSDSEHTNP SVDSTNPSED KIEIPTEPGM  180
DLWLMLEDAL PSSPQKTDTE ERNMWEPPLE PNSFKVSPCS SPSHSFATNC NTGGGGGGGG  240
GGVQALDDAP IEPELWSMIE DGDAGLFSPG MEGAMEEPGV RGNPTGLHEE SSREEGSIIW  300
LEYLEKELGL GGAMDDNQEC LMGPWPEMEG DPVSSYFQKG PSSPSPLDLH DLKVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-271411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00249DAPTransfer from AT1G79180Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008776690.10.0myb-related protein Zm1-like
TrEMBLA0A2H3X0Z80.0A0A2H3X0Z8_PHODC; myb-related protein Zm1-like
STRINGXP_008776690.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.12e-67myb domain protein 63