PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PDK_30s1149851g001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 138aa MW: 16125.5 Da PI: 10.2798 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 160.6 | 6.1e-50 | 4 | 130 | 3 | 128 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 pGfrFhPt+eel+++yL++ v gkkl++ ++i ++++y+++Pw+Lp +k +e+ewyfF++rd+k+++g r+nr+t++g+Wkatg+d+++ PDK_30s1149851g001 4 PGFRFHPTEEELLDFYLRRAVLGKKLQV-DIIGTLNLYRHDPWELPGLAKIGEREWYFFVPRDRKQSNGGRPNRTTEHGFWKATGSDRPIR 93 9***************************.99***************8888899************************************** PP NAM 94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128 s+ ++l+glkktLv+y+grap+g+ktdWvm+eyrl PDK_30s1149851g001 94 SAadPKRLIGLKKTLVYYEGRAPRGSKTDWVMNEYRL 130 98777788***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 51.915 | 2 | 138 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 3.14E-54 | 3 | 135 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.0E-26 | 4 | 130 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MELPGFRFHP TEEELLDFYL RRAVLGKKLQ VDIIGTLNLY RHDPWELPGL AKIGEREWYF 60 FVPRDRKQSN GGRPNRTTEH GFWKATGSDR PIRSAADPKR LIGLKKTLVY YEGRAPRGSK 120 TDWVMNEYRL PDPTTPPK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 3e-49 | 4 | 130 | 17 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_026656011.1 | 1e-98 | NAC domain-containing protein 22-like | ||||
Swissprot | Q10S65 | 9e-82 | NAC22_ORYSJ; NAC domain-containing protein 22 | ||||
TrEMBL | A0A3Q0HMW9 | 3e-97 | A0A3Q0HMW9_PHODC; NAC domain-containing protein 22-like | ||||
STRING | XP_008813554.1 | 1e-99 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1770 | 38 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G17040.1 | 1e-76 | NAC domain containing protein 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|