PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PDK_30s1103021g001

Organism

Phoenix dactylifera

Taxonomic ID

42345

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix

Family

M-type_MADS

Protein Properties

Length: 83aa MW: 9427.81 Da PI: 10.7131

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PDK_30s1103021g001	genome	PDK	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	76.5	2e-24	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+k rqv+fskRr g++KKA+EL vLCdaev + +fs +g+ ye++s PDK_30s1103021g001 10 RIEDKASRQVSFSKRRSGLFKKAHELAVLCDAEVGISVFSASGRPYEFCS 59 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	28.847	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	3.3E-34	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.03E-33	2	61	No hit	No description
PRINTS	PR00404	1.9E-26	3	23	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.24E-26	3	67	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.8E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-26	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-26	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 83 aa Download sequence Send to blast
MRRGKVQLRR IEDKASRQVS FSKRRSGLFK KAHELAVLCD AEVGISVFSA SGRPYEFCSS 60 SRMDDSYTFN TIPVLRQLSL TNP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	6e-16	1	64	1	63	Myocyte-specific enhancer factor 2B
1tqe_Q	6e-16	1	64	1	63	Myocyte-specific enhancer factor 2B
1tqe_R	6e-16	1	64	1	63	Myocyte-specific enhancer factor 2B
1tqe_S	6e-16	1	64	1	63	Myocyte-specific enhancer factor 2B
3mu6_A	5e-16	3	64	2	62	Myocyte-specific enhancer factor 2A
3mu6_B	5e-16	3	64	2	62	Myocyte-specific enhancer factor 2A
3mu6_C	5e-16	3	64	2	62	Myocyte-specific enhancer factor 2A
3mu6_D	5e-16	3	64	2	62	Myocyte-specific enhancer factor 2A
6byy_C	6e-16	1	64	1	63	MEF2 CHIMERA
6byy_D	6e-16	1	64	1	63	MEF2 CHIMERA
6bz1_A	6e-16	1	64	1	63	MEF2 CHIMERA
6bz1_B	6e-16	1	64	1	63	MEF2 CHIMERA
6bz1_C	6e-16	1	64	1	63	MEF2 CHIMERA
6bz1_D	6e-16	1	64	1	63	MEF2 CHIMERA
6c9l_A	6e-16	1	64	1	63	Myocyte-specific enhancer factor 2B
6c9l_B	6e-16	1	64	1	63	Myocyte-specific enhancer factor 2B
6c9l_C	6e-16	1	64	1	63	Myocyte-specific enhancer factor 2B
6c9l_D	6e-16	1	64	1	63	Myocyte-specific enhancer factor 2B
6c9l_E	6e-16	1	64	1	63	Myocyte-specific enhancer factor 2B
6c9l_F	6e-16	1	64	1	63	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable MADS-box transcription factor that functions with J2 and EJ2 in meristem maturation. {ECO:0000269\|PubMed:28528644}.
UniProt	Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269\|PubMed:17951465}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008806429.1	8e-38	MADS-box protein EJ2-like isoform X4
Swissprot	K4BND8	6e-24	MADS4_SOLLC; MADS-box protein 04g005320
Swissprot	Q9XJ61	3e-24	MAD51_ORYSJ; MADS-box transcription factor 51
TrEMBL	A0A2H3Z038	2e-36	A0A2H3Z038_PHODC; MADS-box protein EJ2-like isoform X4
STRING	XP_008806426.1	3e-36	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G24260.3	1e-25	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kim SL,Lee S,Kim HJ,Nam HG,An G OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465] Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Soyk S, et al. Bypassing Negative Epistasis on Yield in Tomato Imposed by a Domestication Gene. Cell, 2017. 169(6): p. 1142-1155.e12 [PMID:28528644]