PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1080961g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family NAC
Protein Properties Length: 258aa    MW: 29756.9 Da    PI: 8.6
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1080961g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.61.1e-48111373128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                         pGfrFhPt+eel+++yL++ v+gkkl++ ++i ++++y+++Pw+Lp  +k +e+ewyfF++rd+++++g r+nr+t++g+Wkatg+d+++ 
  PDK_30s1080961g001  11 PGFRFHPTEEELLDFYLRRAVRGKKLQI-DIIGTLNLYRHDPWELPGLAKIGEREWYFFVPRDRRQSNGGRPNRTTEHGFWKATGSDRPIR 100
                         9***************************.99***************8888899************************************** PP

                 NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         s+   ++l+glkktLv+y+grap+g+ktdWvm+eyr+
  PDK_30s1080961g001 101 SAadPKRLIGLKKTLVYYQGRAPRGSKTDWVMNEYRF 137
                         98777788***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100554.9939156IPR003441NAC domain
SuperFamilySSF1019412.22E-5610156IPR003441NAC domain
PfamPF023655.4E-2511136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEQSGAGLGL PGFRFHPTEE ELLDFYLRRA VRGKKLQIDI IGTLNLYRHD PWELPGLAKI  60
GEREWYFFVP RDRRQSNGGR PNRTTEHGFW KATGSDRPIR SAADPKRLIG LKKTLVYYQG  120
RAPRGSKTDW VMNEYRFPDA TTPPTEDIVL CKIYRKATSL KELEQRAAMA SPNSRSMVDL  180
VLQKCMAVDD DGVKEPEEEV EKEAKVEVLA ESTRSTSLPR LDIPKYNGLE WMQDPFLTQL  240
RSPWMDLWSP YYASVLNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-491115617168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008781351.10.0NAC domain-containing protein 22-like
SwissprotQ10S651e-103NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLA0A2H3XBR70.0A0A2H3XBR7_PHODC; NAC domain-containing protein 22-like
STRINGXP_008781351.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP177038105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.16e-88NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]