PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PDK_30s1075251g002 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 143aa MW: 16182.3 Da PI: 10.3696 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 62.8 | 6.8e-20 | 49 | 95 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd +l +av+++ g++Wk+Ia++++ Rt+ qc +rwqk+l PDK_30s1075251g002 49 KGQWTPEEDAILCRAVQKFRGKNWKKIAECFP-DRTDVQCLHRWQKVL 95 799*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 51.7 | 1.9e-16 | 101 | 142 | 1 | 43 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 +g+W++eEde++++ v +G++ W+tIa+ ++ gR +kqc++r PDK_30s1075251g002 101 KGPWSKEEDEKIIQMVDTYGPKKWSTIAQALP-GRIGKQCRER 142 79******************************.********98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.896 | 44 | 95 | IPR017930 | Myb domain |
SMART | SM00717 | 4.1E-16 | 48 | 97 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.3E-18 | 49 | 95 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.6E-25 | 50 | 102 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.01E-14 | 52 | 95 | No hit | No description |
SuperFamily | SSF46689 | 2.66E-24 | 75 | 142 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.938 | 96 | 143 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-7 | 100 | 143 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.4E-15 | 101 | 142 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.8E-22 | 103 | 142 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.18E-12 | 103 | 142 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MASDKGKSAK KGETSASSST AVQDGSSDEI QRQRPLHGRT TGPTRRSTKG QWTPEEDAIL 60 CRAVQKFRGK NWKKIAECFP DRTDVQCLHR WQKVLNPELV KGPWSKEEDE KIIQMVDTYG 120 PKKWSTIAQA LPGRIGKQCR ERT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 3e-38 | 49 | 142 | 6 | 142 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 3e-38 | 49 | 142 | 6 | 142 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Transcription activator involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:26069325}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Constant levels during cell cycle. Activated by CYCB1. {ECO:0000269|PubMed:17287251}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008795072.1 | 3e-95 | transcription factor MYB3R-1-like isoform X2 | ||||
Swissprot | Q9S7G7 | 6e-60 | MB3R1_ARATH; Transcription factor MYB3R-1 | ||||
TrEMBL | A0A2H3Y8Q9 | 5e-94 | A0A2H3Y8Q9_PHODC; transcription factor MYB3R-1-like isoform X2 | ||||
TrEMBL | A0A2H3ZSV0 | 1e-93 | A0A2H3ZSV0_PHODC; transcription factor MYB3R-1-like isoform X1 | ||||
STRING | XP_008795071.1 | 2e-94 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2495 | 38 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G32730.1 | 3e-62 | Homeodomain-like protein |
Publications ? help Back to Top | |||
---|---|---|---|
|