PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PDK_30s1049951g004 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 121aa MW: 13265.4 Da PI: 10.4762 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 55 | 1.1e-17 | 26 | 59 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 C +C kTp+WR gp g+ktLCnaCG++y++ + PDK_30s1049951g004 26 CMHCEIQKTPQWRAGPMGPKTLCNACGVRYKSGR 59 99*****************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 5.2E-16 | 20 | 70 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 10.857 | 20 | 56 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 3.9E-15 | 24 | 57 | IPR013088 | Zinc finger, NHR/GATA-type |
SuperFamily | SSF57716 | 2.33E-15 | 24 | 83 | No hit | No description |
CDD | cd00202 | 1.17E-11 | 25 | 72 | No hit | No description |
Pfam | PF00320 | 2.2E-15 | 26 | 60 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 26 | 51 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007623 | Biological Process | circadian rhythm | ||||
GO:0009845 | Biological Process | seed germination | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MKQKKKKKCS AGTAAGGDEA PPVRKCMHCE IQKTPQWRAG PMGPKTLCNA CGVRYKSGRL 60 FPEYRPAASP TFVPSLHSNS HRKVVEMRLE ASHRAAAAGL PSPESASKDS CDLLAYIRRR 120 E |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008807395.1 | 3e-83 | GATA transcription factor 8 | ||||
Refseq | XP_026665473.1 | 3e-83 | GATA transcription factor 8 | ||||
Swissprot | Q9SV30 | 3e-40 | GATA8_ARATH; GATA transcription factor 8 | ||||
TrEMBL | A0A2H3Z2F8 | 8e-82 | A0A2H3Z2F8_PHODC; GATA transcription factor 8 | ||||
STRING | XP_008807395.1 | 1e-82 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5169 | 34 | 51 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54810.2 | 1e-42 | GATA family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|