PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1038161g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MYB
Protein Properties Length: 389aa    MW: 42639.6 Da    PI: 7.0039
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1038161g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  PDK_30s1038161g002 14 KGLWSPEEDEKLLKHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                        678*******************************************97 PP

2Myb_DNA-binding50.25.8e-1667110146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg +++eE++l++++++ lG++ W+ Ia+ ++ gRt++++k++w++
  PDK_30s1038161g002  67 RGTFSQEEEDLIIEVHAVLGNR-WSQIAAQLP-GRTDNEIKNFWNS 110
                         899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-28664IPR009057Homeodomain-like
PROSITE profilePS5129419.219961IPR017930Myb domain
SuperFamilySSF466891.5E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-151461IPR001005SANT/Myb domain
CDDcd001672.07E-121761No hitNo description
PROSITE profilePS5129426.14462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-2665116IPR009057Homeodomain-like
SMARTSM007175.1E-1566114IPR001005SANT/Myb domain
PfamPF002497.8E-1567110IPR001005SANT/Myb domain
CDDcd001675.25E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLKHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIE VHAVLGNRWS QIAAQLPGRT DNEIKNFWNS CIKKKLRQRG  120
IDPTTHKPLA ETQQGGDDKM VDKFAGESSN PKNSATTGAP QFLLDRFVAS QDSTSSCRSS  180
NSPGFFPLPQ SSYASDCGGN RTASVGLAVT PNPLLCCCSA MSTLLPSASG SALSTWMGLK  240
PVMDNPPPSC AGISSYWEAA NCSSSSGSSG NTGGGIELQS NSSYFDNGIF PWPDLPPDRD  300
APIQLQGEPE DLKWSEYLHG AFPASAAIQN QSQPLYGDIK TESQFMVDGL STCYLNQQAQ  360
QQQQQQQQQQ ASNIYGKDFQ SVSVAFEQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-31121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008800337.20.0transcription factor MYB61
TrEMBLA0A2H3YLB30.0A0A2H3YLB3_PHODC; transcription factor MYB61
STRINGXP_008800310.11e-178(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.15e-94myb domain protein 61