PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr036879.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 224aa MW: 25327.3 Da PI: 11.3344 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.9 | 5.5e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gk y ++s Pbr036879.1 9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPSGKSYQFAS 59 79**********************************************986 PP | |||||||
2 | K-box | 58.8 | 2.3e-20 | 85 | 160 | 10 | 85 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 ++++e++++e + L+k i +L+ +R+l+Ge+L++L ++eL+qLe+qL++++++iRsk +++ e+++ l++k k Pbr036879.1 85 RARTMEYWRNENEELRKSIGKLEMRLRNLVGEELSTLGVQELKQLERQLKTGVERIRSKMRRIISENVSLLKRKIK 160 46679****************************************************************9999865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.296 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.2E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.96E-31 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.59E-36 | 2 | 70 | No hit | No description |
PRINTS | PR00404 | 2.6E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.6E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 8.7E-17 | 88 | 160 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 10.783 | 89 | 182 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 224 aa Download sequence Send to blast |
MGRGKVELKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP SGKSYQFASH 60 DITRTISMYK REVGLPESNN SSFGRARTME YWRNENEELR KSIGKLEMRL RNLVGEELST 120 LGVQELKQLE RQLKTGVERI RSKMRRIISE NVSLLKRKIK LRELNFADAT CSTTSVGANA 180 RISAFPRPTR RQRSSISLCS RGSKESSGCL IPILPRAHLG SRL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 7e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 7e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 7e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 7e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_A | 7e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_B | 7e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_C | 7e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_D | 7e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor (Probable). Is required, together with TT16/AGL32 for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). {ECO:0000269|PubMed:22176531, ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr036879.1 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP164025 | 0.0 | KP164025.1 Pyrus pyrifolia clone PpTM8-2 TM8-like MADS-box protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009359418.1 | 1e-127 | PREDICTED: MADS-box transcription factor 23-like | ||||
Swissprot | Q38836 | 1e-45 | AGL11_ARATH; Agamous-like MADS-box protein AGL11 | ||||
TrEMBL | A0A0D4ZYR5 | 1e-127 | A0A0D4ZYR5_PYRPY; TM8-like MADS-box protein | ||||
STRING | XP_009359417.1 | 1e-128 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.4 | 2e-48 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|