PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr032787.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 254aa MW: 28991.3 Da PI: 8.6902 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.7 | 8.6e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien rqvtfskRrng+lKKA+ELSvLCdaevaviifs+++klye++s Pbr032787.2 9 KRIENAASRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKDKLYEFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 71.9 | 1.9e-24 | 77 | 171 | 4 | 97 |
K-box 4 ssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 ++++ e++ ++l+ e+a + k+ie L+ +qR+llG+dL+s+ ++eLq++ +qLe+sl++iR++K +ll+eq+e+l+ ke l +en +Lr++ Pbr032787.2 77 EQTNKvEVEQHVQHLKYESAIMAKKIEILEATQRKLLGNDLDSCLVEELQEMSSQLERSLRSIRERKAQLLMEQMENLKAKETLLLQENAKLREE 171 34444478999*********************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.1E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.609 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.5E-34 | 3 | 89 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.24E-42 | 3 | 78 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.4E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 4.4E-22 | 85 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.314 | 88 | 182 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 254 aa Download sequence Send to blast |
MVRGKIEMKR IENAASRQVT FSKRRNGLLK KAYELSVLCD AEVAVIIFSQ KDKLYEFCSS 60 DMRETLTRYR KYAKDHEQTN KVEVEQHVQH LKYESAIMAK KIEILEATQR KLLGNDLDSC 120 LVEELQEMSS QLERSLRSIR ERKAQLLMEQ MENLKAKETL LLQENAKLRE ESGAKLLMEH 180 SAQEKRGSAS VSCEKAGASA SVNYWKQSIM SSEVETELFI GPPIMRSVDR IAVYSNIHQI 240 NNNACQSSLK TIP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 1e-23 | 1 | 85 | 1 | 86 | MEF2 CHIMERA |
6bz1_B | 1e-23 | 1 | 85 | 1 | 86 | MEF2 CHIMERA |
6bz1_C | 1e-23 | 1 | 85 | 1 | 86 | MEF2 CHIMERA |
6bz1_D | 1e-23 | 1 | 85 | 1 | 86 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | Transfer from AT5G62165 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr032787.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP164011 | 0.0 | KP164011.1 Pyrus pyrifolia clone PpSOC1-2 SOC1-like MADS-box protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018499519.1 | 0.0 | PREDICTED: MADS-box protein AGL42-like isoform X1 | ||||
Refseq | XP_018499520.1 | 0.0 | PREDICTED: MADS-box protein AGL42-like isoform X2 | ||||
Swissprot | Q9FIS1 | 3e-75 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A0D4ZY44 | 1e-173 | A0A0D4ZY44_PYRPY; SOC1-like MADS-box protein | ||||
STRING | XP_009347901.1 | 1e-149 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF666 | 30 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 1e-77 | AGAMOUS-like 42 |