PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr025204.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 104aa MW: 11756.4 Da PI: 8.6668 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 38.5 | 3.2e-12 | 65 | 101 | 2 | 38 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTE CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgl 38 C v+gC+ dls+++ey r h+vC+ hsk++vv+v+++ Pbr025204.1 65 CLVNGCRPDLSRCREYRRWHRVCKLHSKTSVVVVRDE 101 *********************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 3.9E-11 | 60 | 101 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 11.246 | 62 | 103 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.31E-10 | 63 | 100 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.1E-6 | 65 | 101 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MEWDFKDSDL AALVGSSISQ TQMKNKPAES LGLDIKKLEE DPMKVSSSRR INGDNNGSDQ 60 LKVLCLVNGC RPDLSRCREY RRWHRVCKLH SKTSVVVVRD EHI* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr025204.1 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009344929.1 | 1e-52 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Refseq | XP_018500406.1 | 1e-52 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Refseq | XP_018500407.1 | 1e-52 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Refseq | XP_018500408.1 | 1e-52 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
TrEMBL | A0A498HKH2 | 6e-48 | A0A498HKH2_MALDO; Uncharacterized protein | ||||
STRING | XP_009344927.1 | 6e-52 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF10031 | 26 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50670.1 | 1e-11 | SBP family protein |