PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr009992.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family STAT
Protein Properties Length: 693aa    MW: 77084 Da    PI: 5.9014
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr009992.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT1803.3e-562213421122
         STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkypfl 98 
                  ldvvll+a+++p ++++ev+asL+yad+g++vek++d eapLL+s dG ef+ +drp+k l+G+asfklkisqLsskcdnr+fr++f+ipkl+kypfl
  Pbr009992.1 221 LDVVLLDAFSHPSNQELEVIASLVYADNGEPVEKTSDGEAPLLASHDGFEFAFSDRPSKTLKGHASFKLKISQLSSKCDNRMFRVMFHIPKLEKYPFL 318
                  8************************************************************************************************* PP

         STAT  99 eavskpirCisrsrntrsssltkk 122
                  +a++ pirCisrsr+tr s++++k
  Pbr009992.1 319 KAFTPPIRCISRSRTTRISTTAWK 342
                  ******************999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF133852.6E-625164No hitNo description
SuperFamilySSF498991.74E-825167IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:2.60.120.2003.1E-526140IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.104.9E-7575656IPR000980SH2 domain
SuperFamilySSF555501.71E-7578645IPR000980SH2 domain
PROSITE profilePS500019.426583665IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 693 aa     Download sequence    Send to blast
MADEAKEREE YSLLKDFRAE IEPKDGAFSL CFWLYLTSSA ASPATLIQEQ SGATGSAPFL  60
VLSEKKKMVL LPLGILHKEA PETCDLSSLS EDSYVSTENE FPTEKWIHVG CEVLSDTLRL  120
HIDGEAVGNK SMSSLFNKDS IASGLTKIIL VSGGREDNSL QGYICNHKVL PLTSSILEYY  180
AKDPPLKLSI DNSSASEIEV DSDGVWSIVG GKASCRRIFS LDVVLLDAFS HPSNQELEVI  240
ASLVYADNGE PVEKTSDGEA PLLASHDGFE FAFSDRPSKT LKGHASFKLK ISQLSSKCDN  300
RMFRVMFHIP KLEKYPFLKA FTPPIRCISR SRTTRISTTA WKRPASASDP VSLSQLSGLG  360
DETLELQHSS VNEEKLSPSS KRCRLGQDRI RATVSALEQP DDECNSHART AKQVEALAKN  420
VVGRPNSVEE IDDSRTDSER PEVRNPDLMS TSSSRNPISD ATIFKYCLAS LSEKTLLLKE  480
IASTASNEEI LSFSHQVSLY SGCSHHRHQV EMAKSLVEEG TKAWNSISQN NRQDFELLRR  540
IAGCQEHLAK ENFEKLWCWL YPVAFTLSRD GINTMWSSKS PKWIEGFITK EESETSLQGS  600
RGFQEPGTFV LRFPTSRSWP HPDAGSLVVT YVGSKHTIHH RLISLDHMFS PAEREQNAKP  660
LQDMLLAEPE LSQLGRQEIC SIYFTVHCIT IY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPbr009992.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009339361.10.0PREDICTED: uncharacterized protein LOC103931564
RefseqXP_009376699.10.0PREDICTED: uncharacterized protein LOC103965372
SwissprotQ56XZ10.0SHB_ARATH; SH2 domain-containing protein B
TrEMBLA0A498IPG00.0A0A498IPG0_MALDO; Uncharacterized protein
STRINGXP_009339361.10.0(Pyrus x bretschneideri)
STRINGXP_009376699.10.0(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.20.0SH2 domain protein B
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]