PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr006218.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 83aa MW: 9036.09 Da PI: 6.7929 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 31.7 | 2.7e-10 | 12 | 44 | 59 | 91 |
EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS B3 59 yvltkGWkeFvkangLkegDfvvFkldgrsefe 91 +++GW+eF+k ngL+e D+vvF+++g++ f+ Pbr006218.1 12 LAFEEGWEEFAKRNGLNEEDIVVFEHKGDMVFN 44 56899*********************9998885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50863 | 9.53 | 1 | 51 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 3.14E-10 | 13 | 58 | IPR015300 | DNA-binding pseudobarrel domain |
Gene3D | G3DSA:2.40.330.10 | 7.5E-10 | 13 | 59 | IPR015300 | DNA-binding pseudobarrel domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
MSKSVGAVME KLAFEEGWEE FAKRNGLNEE DIVVFEHKGD MVFNAVAYDS GGCEKKYPPD 60 SGVAANRMAT SSKARSNKHH RG* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr006218.1 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028962513.1 | 1e-38 | B3 domain-containing protein At3g18960-like | ||||
TrEMBL | A0A498J6W4 | 4e-34 | A0A498J6W4_MALDO; Uncharacterized protein | ||||
STRING | XP_008357222.1 | 4e-36 | (Malus domestica) | ||||
STRING | XP_008377458.1 | 2e-37 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14574 | 9 | 17 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G31690.1 | 1e-10 | B3 family protein |