PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr003814.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 143aa MW: 14751.4 Da PI: 9.1058 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 79.8 | 3.9e-25 | 80 | 134 | 1 | 55 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsef 55 +CqvegC++dls+ak y++rhkvC hsk+p+v+v+gleqrfCqqCsr + f Pbr003814.1 80 RCQVEGCQVDLSDAKAYYSRHKVCGLHSKTPTVIVAGLEQRFCQQCSRGTPIARF 134 6**********************************************97666655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 6.2E-27 | 74 | 135 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 4.05E-24 | 78 | 134 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 19.17 | 78 | 142 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.1E-20 | 81 | 135 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MGSSSMTESG SSSSSSPPNS SAESLNGLKF GQTIYFEDVG FGAQHKSSSG SAAGSSSAGA 60 TPPKKQRGGG NMGQLGQPPR CQVEGCQVDL SDAKAYYSRH KVCGLHSKTP TVIVAGLEQR 120 FCQQCSRGTP IARFTVSTFK FC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-15 | 81 | 134 | 11 | 64 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr003814.1 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM077442 | 0.0 | KM077442.1 Pyrus x bretschneideri squamosa promoter binding protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008392088.1 | 8e-85 | squamosa promoter-binding-like protein 9 | ||||
TrEMBL | A0A498I3G2 | 2e-83 | A0A498I3G2_MALDO; Uncharacterized protein | ||||
STRING | XP_008392088.1 | 3e-84 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4208 | 33 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57920.1 | 2e-24 | squamosa promoter binding protein-like 15 |