PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr002303.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 129aa MW: 14673.7 Da PI: 8.6111 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 83 | 4.1e-26 | 71 | 128 | 2 | 59 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeek 59 C v+gC+adls+++eyhrrh++Ce sk+pv++v+g+++rfCqqCsr ++l efDe+k Pbr002303.1 71 CLVDGCRADLSRCREYHRRHRICELRSKTPVAVVKGEQKRFCQQCSRVYSLVEFDEGK 128 ********************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 4.0E-25 | 66 | 128 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 21.64 | 68 | 128 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 2.22E-24 | 69 | 128 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.8E-18 | 71 | 128 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
MEMLLRGDKS IMESDTEEGD QQKVSSPQMK NRPAESLGLD FKKLQEDPIK LSSSRRINGS 60 NNGSDHLKVL CLVDGCRADL SRCREYHRRH RICELRSKTP VAVVKGEQKR FCQQCSRVYS 120 LVEFDEGK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj0_A | 1e-17 | 69 | 125 | 4 | 60 | squamosa promoter-binding protein-like 12 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr002303.1 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF673853 | 3e-75 | KF673853.1 Malus domestica cultivar Fuji SBP-box transcription factor (SPL11) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009344929.1 | 2e-66 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Refseq | XP_018500406.1 | 2e-66 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Refseq | XP_018500407.1 | 2e-66 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Refseq | XP_018500408.1 | 2e-66 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
TrEMBL | A0A498HKH2 | 4e-61 | A0A498HKH2_MALDO; Uncharacterized protein | ||||
STRING | XP_009344927.1 | 4e-63 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF10031 | 26 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50670.1 | 5e-26 | SBP family protein |