PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr002300.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 101aa MW: 11522.2 Da PI: 9.7534 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 83.8 | 2.2e-26 | 43 | 100 | 2 | 59 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeek 59 C v+gC+adls+++eyhrrh++Ce sk+pv++v+g+++rfCqqCsr ++l efDe+k Pbr002300.1 43 CLVDGCRADLSRCREYHRRHRICELRSKTPVAVVKGEQKRFCQQCSRVYSLVEFDEGK 100 ********************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 2.0E-25 | 38 | 100 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 21.64 | 40 | 100 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.14E-24 | 41 | 100 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.5E-18 | 43 | 100 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MKNRPAESLG LDFKKLQEDP IKLSSSRRIN GSNNGSDHLK VLCLVDGCRA DLSRCREYHR 60 RHRICELRSK TPVAVVKGEQ KRFCQQCSRV YSLVEFDEGK * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj0_A | 5e-18 | 41 | 97 | 4 | 60 | squamosa promoter-binding protein-like 12 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr002300.1 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF673853 | 2e-75 | KF673853.1 Malus domestica cultivar Fuji SBP-box transcription factor (SPL11) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009344929.1 | 5e-63 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Refseq | XP_018500406.1 | 5e-63 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Refseq | XP_018500407.1 | 5e-63 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Refseq | XP_018500408.1 | 5e-63 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Swissprot | Q2R3Y1 | 1e-25 | SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19 | ||||
TrEMBL | A0A498HKH2 | 6e-58 | A0A498HKH2_MALDO; Uncharacterized protein | ||||
STRING | XP_009344927.1 | 8e-60 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF10031 | 26 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50670.1 | 3e-27 | SBP family protein |