PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pbr001920.1

Organism

Pyrus bretschneideri

Taxonomic ID

225117

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus

Family

TALE

Protein Properties

Length: 136aa MW: 15889.8 Da PI: 8.4555

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pbr001920.1	genome	CPETR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	27.4	5.6e-09	84	117	22	55
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp+++++ LA+ ++L+++q+ +WF N+R ++ Pbr001920.1 84 WPYPTEADKISLAQVTRLDQKQINNWFINQRKRH 117 59*****************************985 PP
2	ELK	32.9	1.4e-11	37	57	1	21
ELK 1 ELKhqLlrKYsgyLgsLkqEF 21 ELK+ Llr Ysgy+++Lk EF Pbr001920.1 37 ELKDKLLRRYSGYISTLKREF 57 9*******************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM01188	1.7E-6	37	58	IPR005539	ELK domain
PROSITE profile	PS51213	10.65	37	57	IPR005539	ELK domain
Pfam	PF03789	8.5E-10	37	57	IPR005539	ELK domain
PROSITE profile	PS50071	11.483	57	120	IPR001356	Homeobox domain
SMART	SM00389	3.6E-10	59	124	IPR001356	Homeobox domain
SuperFamily	SSF46689	9.56E-19	59	131	IPR009057	Homeodomain-like
CDD	cd00086	6.81E-12	60	121	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.2E-26	62	122	IPR009057	Homeodomain-like
Pfam	PF05920	7.7E-16	77	116	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	95	118	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 136 aa Download sequence Send to blast
MLDLHANDDA AGSSDEGDWS GGEIEAQDSP RTNEDHELKD KLLRRYSGYI STLKREFTKK 60 KKNGKLPREA RKILFDWWNL HDKWPYPTEA DKISLAQVTR LDQKQINNWF INQRKRHWKP 120 SENMQYAVMD SLCGP*

Functional Description ? help Back to Top
Source	Description
UniProt	May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'.
UniProt	Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269\|PubMed:16798887}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pbr001920.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269\|PubMed:11311158, ECO:0000269\|PubMed:16798887}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009362982.1	1e-90	PREDICTED: homeobox protein knotted-1-like 6 isoform X1
Swissprot	P46640	4e-48	KNAT2_ARATH; Homeobox protein knotted-1-like 2
Swissprot	Q84JS6	6e-48	KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBL	A0A498I264	2e-84	A0A498I264_MALDO; Uncharacterized protein
STRING	XP_009362982.1	4e-90	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF620	34	125

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G23380.2	8e-48	KNOTTED1-like homeobox gene 6

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Zhang XL,Yang ZP,Zhang J,Zhang LG Ectopic expression of BraYAB1-702, a member of YABBY gene family in Chinese cabbage, causes leaf curling, inhibition of development of shoot apical meristem and flowering stage delaying in Arabidopsis thaliana. Int J Mol Sci, 2013. 14(7): p. 14872-91 [PMID:23863694] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Scofield S,Dewitte W,Murray JA STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1. Plant Signal Behav, 2018. [PMID:24776954] Lee JE,Lampugnani ER,Bacic A,Golz JF SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis. Plant J., 2014. 80(1): p. 122-35 [PMID:25060324] Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis. Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71 [PMID:26108442] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] Li Z, et al. Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] Lozano-Sotomayor P, et al. Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana. Plant J., 2016. 88(3): p. 437-451 [PMID:27402171]