PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr001457.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 239aa MW: 27117.1 Da PI: 8.2051 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 95.3 | 2.7e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaevaviifs+++klye++s Pbr001457.1 9 KRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKDKLYEFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 62.1 | 2.1e-21 | 77 | 157 | 5 | 84 |
K-box 5 sgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 ++++ e++ ++l++e+a + k+ie L+ +qR+llG+dL+s+ ++eLq++ +qLe+sl++iR++ +ll+eq+e+l+ k Pbr001457.1 77 QTNKvEVEQQVQHLKHEAAIMTKKIEILEASQRKLLGNDLDSCVVEELQEISSQLERSLRSIREREAQLLMEQMENLKAKS 157 3333478899********************************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.4E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.973 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.84E-34 | 3 | 81 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.39E-42 | 3 | 72 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.8E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.6E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.8E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.8E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.3E-18 | 84 | 157 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 12.725 | 87 | 184 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 239 aa Download sequence Send to blast |
MVRGKIEMKR IENATSRQVT FSKRRNGLLK KAYELSVLCD AEVAVIIFSQ KDKLYEFCSS 60 DMQETLTRYH KYAKEEQTNK VEVEQQVQHL KHEAAIMTKK IEILEASQRK LLGNDLDSCV 120 VEELQEISSQ LERSLRSIRE REAQLLMEQM ENLKAKSGAK LLMEHSAQEK RGSASVSCEK 180 AGASASVNYW KQSIMSSEVE TELFIGPPIM RSVDRIAVYS NIHQINNNAC QSSLKTIP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6bz1_A | 1e-22 | 1 | 84 | 1 | 86 | MEF2 CHIMERA |
6bz1_B | 1e-22 | 1 | 84 | 1 | 86 | MEF2 CHIMERA |
6bz1_C | 1e-22 | 1 | 84 | 1 | 86 | MEF2 CHIMERA |
6bz1_D | 1e-22 | 1 | 84 | 1 | 86 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr001457.1 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP164011 | 0.0 | KP164011.1 Pyrus pyrifolia clone PpSOC1-2 SOC1-like MADS-box protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018499521.1 | 1e-165 | PREDICTED: MADS-box protein AGL42-like isoform X3 | ||||
Swissprot | Q9FIS1 | 5e-71 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A0D4ZY44 | 1e-170 | A0A0D4ZY44_PYRPY; SOC1-like MADS-box protein | ||||
STRING | XP_009347901.1 | 1e-126 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF666 | 30 | 102 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 8e-63 | AGAMOUS-like 42 |