PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr000388.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 118aa MW: 12930.4 Da PI: 5.2777 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 71.6 | 1.4e-22 | 70 | 117 | 1 | 48 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 +C+v++C+adls++k+y+rrhkvC+vh+kap+vl+ g qrfCqqCsr Pbr000388.1 70 CCKVDSCNADLSDLKQYYRRHKVCDVHAKAPAVLMGGFLQRFCQQCSR 117 6**********************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 2.2E-23 | 64 | 117 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 19.751 | 68 | 117 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.44E-21 | 69 | 117 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 4.3E-18 | 71 | 117 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 118 aa Download sequence Send to blast |
MEPGRAHGKK TLVKYEEEEE EEEEEESRSG TPSIVDGEDE RRDTVMMMNS TAPSPTGRRS 60 GAGGSTAGPC CKVDSCNADL SDLKQYYRRH KVCDVHAKAP AVLMGGFLQR FCQQCSR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj0_A | 8e-20 | 67 | 117 | 2 | 52 | squamosa promoter-binding protein-like 12 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr000388.1 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF673852 | 1e-153 | KF673852.1 Malus domestica cultivar Fuji SBP-box transcription factor (SPL2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009342532.1 | 1e-82 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q38740 | 1e-20 | SBP2_ANTMA; Squamosa promoter-binding protein 2 | ||||
TrEMBL | A0A498JUM1 | 2e-63 | A0A498JUM1_MALDO; Uncharacterized protein | ||||
STRING | XP_009342532.1 | 4e-82 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G60030.1 | 6e-21 | squamosa promoter-binding protein-like 12 |
Publications ? help Back to Top | |||
---|---|---|---|
|