PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pbr000386.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 127aa MW: 14058.5 Da PI: 4.6557 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 75.6 | 8.1e-24 | 74 | 123 | 1 | 50 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEE CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfh 50 +C+v++C+adls++k+y+rrhkvC+vh+kap+vl+ g +qrfCqqCsr + Pbr000386.1 74 CCKVDSCNADLSDLKQYYRRHKVCDVHAKAPAVLMGGFRQRFCQQCSRVY 123 6***********************************************76 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 3.7E-24 | 68 | 122 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 20.179 | 72 | 126 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 9.03E-23 | 73 | 124 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.3E-18 | 75 | 122 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 127 aa Download sequence Send to blast |
MESGRAHGKS TLVKYEEEEE EEEEEEEEEE SRSGTPSIVD GEDERRDTVM MMNSTAPSPT 60 GRRSGAGGST AGPCCKVDSC NADLSDLKQY YRRHKVCDVH AKAPAVLMGG FRQRFCQQCS 120 RVYLFP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj0_A | 7e-20 | 71 | 125 | 2 | 56 | squamosa promoter-binding protein-like 12 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269|PubMed:16554053}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pbr000386.1 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF673852 | 1e-149 | KF673852.1 Malus domestica cultivar Fuji SBP-box transcription factor (SPL2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009342532.1 | 7e-69 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
Swissprot | Q9S7P5 | 4e-19 | SPL12_ARATH; Squamosa promoter-binding-like protein 12 | ||||
TrEMBL | D9ZJC2 | 8e-65 | D9ZJC2_MALDO; SBP-box transcription factor | ||||
STRING | XP_009342532.1 | 3e-68 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G60030.1 | 1e-20 | squamosa promoter-binding protein-like 12 |
Publications ? help Back to Top | |||
---|---|---|---|
|