PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf03779g00019.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 184aa MW: 21155.1 Da PI: 9.8512 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55.4 | 1.4e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+++Ed++l+d+++++G g+W+ ++ g+ R++k+c++rw +yl Peaxi162Scf03779g00019.1 14 RGAWSKQEDQKLIDYITKHGAGCWRNLPKAAGLLRCGKSCRLRWMNYL 61 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 56.8 | 5.1e-18 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l Peaxi162Scf03779g00019.1 67 RGNFSEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.178 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.13E-29 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.0E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-15 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-22 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.85E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.28 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 3.3E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-16 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.7E-27 | 69 | 117 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.71E-12 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
MRKACCDNKE EMHRGAWSKQ EDQKLIDYIT KHGAGCWRNL PKAAGLLRCG KSCRLRWMNY 60 LSPNLKRGNF SEDEEDLIIK LHALLGNRWS LIAGRLPGRT DNEVKNYWNS HLRRKLIKMG 120 IDPKNHRISH YLHRKRLEYW SENSSRGTDH EVVSDAGSSC AKHQPSSLPD LNSPPSIHSS 180 CAQP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-30 | 11 | 116 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18541146, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF985023 | 0.0 | KF985023.1 Petunia x hybrida cultivar Mitchell R2R3-MYB anthocyanin repressor (MYB27) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016502778.1 | 1e-109 | PREDICTED: transcription factor MYB3-like | ||||
Swissprot | Q9S9K9 | 8e-67 | MYB3_ARATH; Transcription factor MYB3 | ||||
TrEMBL | A0A023PKB4 | 1e-132 | A0A023PKB4_PETHY; R2R3-MYB anthocyanin repressor | ||||
STRING | XP_009596675.1 | 1e-108 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22640.1 | 3e-69 | myb domain protein 3 |