PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00939g00235.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRAS
Protein Properties Length: 1190aa    MW: 132453 Da    PI: 4.8789
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00939g00235.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS369.64.2e-1131545153374
                      GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsev 87 
                               ++L++cA+av++++l+ a+ l+  l+ la+++  + +++a+yf++AL +r++++  +  +++  s       ++ l    +f+++
  Peaxi162Scf00939g00235.1 154 TTLMACADAVQQNNLNVADILVRDLKMLAAQQFGAKKKVATYFAQALDQRIHGT--NQQHIVDYSY-----YTDDL-LWMIFYKT 230
                               68***************************************************2..1122222222.....23333.3458**** PP

                      GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeel 172
                               +P++kf++l+ NqaIl+a+++++rvH+iDf++++GlQWpaL++aLa Rp+gpp + +T++g+ +s++ ++ +++g +LakfAe++
  Peaxi162Scf00939g00235.1 231 CPYIKFAYLASNQAILDAFANSNRVHVIDFSLKEGLQWPALMEALARRPGGPPAFWLTALGPLRSNNINNFQQIGGKLAKFAETV 315
                               ************************************************************************************* PP

                      GRAS 173 gvpfefnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                               gv+fef+ +++++l+d++   L+++p   +a+aVn+v++lh+ l+ s+++e+    +L+ +k+++Pk+v+++eqea+hn++ +++
  Peaxi162Scf00939g00235.1 316 GVEFEFREILVNSLADVDATVLNIRPssVDAVAVNSVFELHHALSTSGTIEK----LLNSIKEMQPKIVTITEQEANHNGHALVD 396
                               **************************999***************99999999....***************************** PP

                      GRAS 256 rflealeyysalfdsleak..lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                               rf ea +yys++f+s+e++  l ++s    +vE+  lgr+i nvvaceg+er+erhetl++W+ r+++aGF  v+l++++++qa+
  Peaxi162Scf00939g00235.1 397 RFKEAWDYYSTMFESMENSevLQPNSPYSEMVEKY-LGRQINNVVACEGTERVERHETLSQWQVRMNSAGFVRVHLRSNTYNQAR 480
                               ****************5443377788888899888.************************************************* PP

                      GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +ll +++  gy+ve ++g++ l W++rpL+++SaW+
  Peaxi162Scf00939g00235.1 481 SLLLQHSRAGYKVEVNDGCM-LSWNSRPLIAISAWQ 515
                               ***************99986.8*************6 PP

2GRAS392.44.8e-12068910492374
                      GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84  
                                v +L++cAeav++++l+la+al+  l  la+++    +++a+yf++AL +r+++        ++p+++     +e+ + +  f
  Peaxi162Scf00939g00235.1  689 VVTLMACAEAVQQNNLNLADALVRDLGILAAQQSGVKKKVATYFAQALDRRIHE--------MNPQNN----IVESDFLQMHF 759 
                                568**************************************************9........444333....4555555556* PP

                      GRAS   85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLak 167 
                                ++++P+l+f+hltaNqaIlea+ +++r+H+iDf+++qGlQWpaL+q La R++gpp +R+Tg+g+ +++++++l e+g++La+
  Peaxi162Scf00939g00235.1  760 NNTCPYLRFAHLTANQAILEAFGSSNRIHVIDFSLKQGLQWPALMQDLARRADGPPVFRLTGIGPTQPDNTDALWEIGRKLAE 842 
                                *********************************************************************************** PP

                      GRAS  168 fAeelgvpfefnvlvakrledleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh 248 
                                fAee+g++f+f+ + +++l+d++ ++++++p   EalaVn+v++lh+ l+++++++     +L+ +k+++P++v+++eqead 
  Peaxi162Scf00939g00235.1  843 FAEEIGLEFHFSGFKVHSLADIDASRMNIRPsnVEALAVNSVFALHHALSRPGAIDT----LLNSIKEMQPNIVTITEQEADN 921 
                                *****************************99989***************66666666....********************** PP

                      GRAS  249 nsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls 330 
                                n++ Fl+rf e+ +yys++fds+ +++ ++ +++++ +  ++lgrei n+vaceg+er+erhetl++Wr r+++aGF pv++ 
  Peaxi162Scf00939g00235.1  922 NESIFLDRFKESWDYYSTMFDSMgNSGSAQPNSQDSEMADQYLGREIYNMVACEGSERVERHETLSQWRVRMNSAGFIPVQIH 1004
                                ***********************8788888889999999999***************************************** PP

                      GRAS  331 ekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374 
                                +ka+ qa+ ll  ++ ++gyrv + +g+l+l W +rpL+++SaW+
  Peaxi162Scf00939g00235.1 1005 SKAYHQANILLFLYEyKHGYRVAKADGCLTLIWGNRPLITTSAWQ 1049
                                ********************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.659126496IPR005202Transcription factor GRAS
PfamPF035141.4E-110154515IPR005202Transcription factor GRAS
PROSITE profilePS5098559.7176621028IPR005202Transcription factor GRAS
PfamPF035141.7E-1176891049IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1190 aa     Download sequence    Send to blast
MSSIESMMED DDSYLSNTDA IIYGTSDHSG WGGDSMISDP NIALSTTSTD DHYQLQISIA  60
AGDGGDASTI VSSVSSSSWF MNNNKQSDYQ QETRVFFVDY RATSGFAICQ NSHKEELEGP  120
ESSNRLKSCA GLELGLTLNI AGALNNGTRG RLFTTLMACA DAVQQNNLNV ADILVRDLKM  180
LAAQQFGAKK KVATYFAQAL DQRIHGTNQQ HIVDYSYYTD DLLWMIFYKT CPYIKFAYLA  240
SNQAILDAFA NSNRVHVIDF SLKEGLQWPA LMEALARRPG GPPAFWLTAL GPLRSNNINN  300
FQQIGGKLAK FAETVGVEFE FREILVNSLA DVDATVLNIR PSSVDAVAVN SVFELHHALS  360
TSGTIEKLLN SIKEMQPKIV TITEQEANHN GHALVDRFKE AWDYYSTMFE SMENSEVLQP  420
NSPYSEMVEK YLGRQINNVV ACEGTERVER HETLSQWQVR MNSAGFVRVH LRSNTYNQAR  480
SLLLQHSRAG YKVEVNDGCM LSWNSRPLIA ISAWQLAPPR SRKVTPEICK LKEKRRRFSE  540
MSSMDTMMEE DDSILSNTDA IIFGTSDHSG WAGDSMISDT NIVLSSTSTD EQYQQQISTA  600
VGDGGDDSTI VSSGASSSWF MNNNKQSEIR IFNVDFRALS GVALRSTSKN KENKGSESNQ  660
RSCTISEFHG GSLEKIGGAV NEEGSDRLVV TLMACAEAVQ QNNLNLADAL VRDLGILAAQ  720
QSGVKKKVAT YFAQALDRRI HEMNPQNNIV ESDFLQMHFN NTCPYLRFAH LTANQAILEA  780
FGSSNRIHVI DFSLKQGLQW PALMQDLARR ADGPPVFRLT GIGPTQPDNT DALWEIGRKL  840
AEFAEEIGLE FHFSGFKVHS LADIDASRMN IRPSNVEALA VNSVFALHHA LSRPGAIDTL  900
LNSIKEMQPN IVTITEQEAD NNESIFLDRF KESWDYYSTM FDSMGNSGSA QPNSQDSEMA  960
DQYLGREIYN MVACEGSERV ERHETLSQWR VRMNSAGFIP VQIHSKAYHQ ANILLFLYEY  1020
KHGYRVAKAD GCLTLIWGNR PLITTSAWQL APPKKMWSSK EMSMDTTMEE EDSYFSNTDA  1080
IFNGISDHSA WAGESLISDP NIASSSTSTD NHYHQIISTA AGSGDDDDLM VVSSSASCSW  1140
FENSNNQLID HQQEVRIFNI DFRALSEVAT VCNNNNTNKE EKKEISVRLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A2e-54159104825381Protein SCARECROW
5b3h_D2e-54159104825381Protein SCARECROW
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1532537EKRRRF
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). Its degradation is not essential for germination. {ECO:0000250, ECO:0000269|PubMed:15347801}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249633.31e-173DELLA protein GAI
RefseqXP_022844159.11e-172DELLA protein GAI-like
SwissprotQ7Y1B61e-161GAI_SOLLC; DELLA protein GAI
TrEMBLA0A3Q7IN050.0A0A3Q7IN05_SOLLC; Uncharacterized protein
STRINGSolyc10g086380.1.11e-172(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.11e-149GRAS family protein
Publications ? help Back to Top
  1. Nir I, et al.
    The Tomato DELLA Protein PROCERA Acts in Guard Cells to Promote Stomatal Closure.
    Plant Cell, 2017. 29(12): p. 3186-3197
    [PMID:29150547]