PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00803g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRAS
Protein Properties Length: 765aa    MW: 82805.4 Da    PI: 5.7584
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00803g00003.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS337.91.8e-1034057642374
                      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfse 86 
                               +++L+++Ae v++g+  laq +Larl+++ sp g+p+ R+a+y +eAL+  l+ ++++l  ++++s+ s    + ++ a+k fse
  Peaxi162Scf00803g00003.1 405 IDQLFKAAELVQTGNPVLAQGILARLNHQLSPIGKPFYRAAFYCKEALQLLLHANTNNLNPSMASSPFS---LIFKIGAYKSFSE 486
                               689***************************************************999999888888888...************* PP

                      GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAee 171
                               +sP+ +f+++t+Nqa+le ++g er+Hi+Dfdi++G+QW++L+q+La R++g+p+l++T+++sp+++++ el  t+e+L +fA+e
  Peaxi162Scf00803g00003.1 487 ISPVAQFANFTCNQALLEVLDGFERIHIVDFDIGYGGQWASLMQELALRSGGAPTLKVTALASPSTHDQLELGLTRENLIQFASE 571
                               ************************************************************************************* PP

                      GRAS 172 lgvpfefnvlvakrledleleeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFl 254
                               +++ fef++l  ++l++   ++L   v+++Ea+aVnl  +  + +  ++sl+     vL++vk+lsP++vv v++ +d+++ +F 
  Peaxi162Scf00803g00003.1 572 INMAFEFEILSIDSLNST-SWSLppLVSENEAIAVNLPASSLSSY--QLSLPL----VLRFVKQLSPRIVVSVDRGCDRTDLPFP 649
                               *********977766665.4555334788**********777776..555555....**************************** PP

                      GRAS 255 erflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                               +++++al+ ys l++sl+a    + ++ +k+Er+ll++ i+ +v+ + ++     e+ ++Wr+ + ++G++p+pls+++++qa++
  Peaxi162Scf00803g00003.1 650 NHVIQALQSYSNLLESLDAV-NVNFDALQKIERFLLQPGIERIVMGRFRS----PEKTQHWRSLFLSSGLSPLPLSNFTESQAEC 729
                               *****************665.3466999****************998877....9****************************** PP

                      GRAS 340 llrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               ++++++++g++ve+++ slvl+W++++Lvs+SaWr
  Peaxi162Scf00803g00003.1 730 VVKRTPVRGFHVEKRQSSLVLCWQRKELVSASAWR 764
                               **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.004378744IPR005202Transcription factor GRAS
PfamPF035146.3E-101405764IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
MKGMPLPFEF EGKGVLDLDI LFNKNSILNS WNNKNSHNSS TSKESCYFVN SPSAVLDTIR  60
SPIRPITSSS TLSSSLGGGG GGGTASTDTA GGVAAVSTNP SSKWQQQQQD NTTATSSNVG  120
AESELPPPSL EMGGGGGTAT AAAAATEEWE GGISEMASPC QEQSILRWIM GDVDDPSMAN  180
LNKVLQVSGP VDYEFNGGFG VVDQGFGVDP ANQIGSFMPS VSVSSSSFPP TSARMNSDKI  240
GLGSNTATNL SQNPIFPSLS NNLGPGGFGQ AQQQPFENSD LKPQGFNSQF LINQHQTQIP  300
QNPSFLLPLP FAQQEQNLVL PPQAKRHNPG TIGGLEQGSQ ISKGLFLDAG QQQPTPPQGL  360
AHQLQLLPHF RPGAMGTKPK MVGEEMGQFH QLQQHQQQQQ QQAIIDQLFK AAELVQTGNP  420
VLAQGILARL NHQLSPIGKP FYRAAFYCKE ALQLLLHANT NNLNPSMASS PFSLIFKIGA  480
YKSFSEISPV AQFANFTCNQ ALLEVLDGFE RIHIVDFDIG YGGQWASLMQ ELALRSGGAP  540
TLKVTALASP STHDQLELGL TRENLIQFAS EINMAFEFEI LSIDSLNSTS WSLPPLVSEN  600
EAIAVNLPAS SLSSYQLSLP LVLRFVKQLS PRIVVSVDRG CDRTDLPFPN HVIQALQSYS  660
NLLESLDAVN VNFDALQKIE RFLLQPGIER IVMGRFRSPE KTQHWRSLFL SSGLSPLPLS  720
NFTESQAECV VKRTPVRGFH VEKRQSSLVL CWQRKELVSA SAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-354047644375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015062026.10.0scarecrow-like protein 22
TrEMBLA0A0V0IWJ20.0A0A0V0IWJ2_SOLCH; Putative scarecrow-like protein 22-like
STRINGPGSC0003DMT4000667990.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-136GRAS family protein