PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00776g00311.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRAS
Protein Properties Length: 447aa    MW: 49240.6 Da    PI: 6.8326
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00776g00311.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS257.16.2e-791633901230
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               l+++L++cA+avs+gdl  aq l+++l++++s +g+p+qRl ay++e+L arla s+s+++k+l+++e +   s e l+++++++
  Peaxi162Scf00776g00311.1 163 LKHVLVACAKAVSDGDLLTAQLLISELRQMVSVSGEPIQRLGAYILEGLVARLAASGSSICKSLRCKEPA---SFELLSYMHVLY 244
                               689******************************************************************9...9*********** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakf 168
                               e++P++kf+++ aN aI ea++ e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp++RiTg+++++s   +   l+ +g+rL+k+
  Peaxi162Scf00776g00311.1 245 EICPYFKFGYMSANGAIAEAMKDENRVHIIDFQITQGSQWVTLIQAFAARPGGPPHIRITGIDDSTSAyaRGGGLNIVGKRLSKL 329
                               ****************************************************************998899999************ PP

                      GRAS 169 AeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLkl 230
                               Ae+++vpfef++ +a + +d+++e+L ++pgEalaVn+++ lh+++desvs+e++rd++L++
  Peaxi162Scf00776g00311.1 330 AEAFKVPFEFHA-AAMSGSDVQPENLGIRPGEALAVNFAFTLHHMPDESVSTENHRDRLLRM 390
                               ************.899********************************************97 PP

2GRAS47.92.3e-15391447317374
                      GRAS 317 erleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               +r+++aGF+p+pls+ +++++k+ll+ +++  yr+ee++g+l+lgW++r Lv+ +aW+
  Peaxi162Scf00776g00311.1 391 SRFRMAGFSPYPLSSLVNATIKTLLESYSD-KYRLEERDGALYLGWMNRDLVASCAWK 447
                               69***************************5.5*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.015137447IPR005202Transcription factor GRAS
PfamPF035142.1E-76163390IPR005202Transcription factor GRAS
PfamPF035148.0E-13391447IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MKASQRIRRS AMSNTLYYQP VQKAEPYCLP QFQSLDNHLS YINGSHGGNN SFQTASGSYA  60
SHHSPATASF SSNGSPICHQ ESQSNLSDAR KSPDTNYSSP ISGSCITDDV NDFMSKLKEL  120
ETVMLGPDSD FLESYDNSLP SSIASPEINS WRQMMEATPR RDLKHVLVAC AKAVSDGDLL  180
TAQLLISELR QMVSVSGEPI QRLGAYILEG LVARLAASGS SICKSLRCKE PASFELLSYM  240
HVLYEICPYF KFGYMSANGA IAEAMKDENR VHIIDFQITQ GSQWVTLIQA FAARPGGPPH  300
IRITGIDDST SAYARGGGLN IVGKRLSKLA EAFKVPFEFH AAAMSGSDVQ PENLGIRPGE  360
ALAVNFAFTL HHMPDESVST ENHRDRLLRM SRFRMAGFSP YPLSSLVNAT IKTLLESYSD  420
KYRLEERDGA LYLGWMNRDL VASCAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-3417038926239Protein SCARECROW
5b3h_A1e-3417038925238Protein SCARECROW
5b3h_D1e-3417038925238Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019250098.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_019250099.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL71e-151PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A1J6I6W30.0A0A1J6I6W3_NICAT; Scarecrow-like transcription factor pat1
STRINGXP_009784447.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-154GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]