PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00725g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB
Protein Properties Length: 210aa    MW: 24675.4 Da    PI: 7.3457
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00725g00019.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding353.2e-111861344
                              SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
           Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                               WT  Ed+l+ +a  +++ +   +W++Iar+++ g+t++++  ++
  Peaxi162Scf00725g00019.1 18 TWTRLEDKLFEQALVMYPENdieRWSKIARHVP-GKTREDVMAHY 61
                              7********************************.********998 PP

2Myb_DNA-binding44.43.8e-14119163347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  Peaxi162Scf00725g00019.1 119 PWTEEEHRLFLIGLDKYGKGDWRSISRNVVVTRTPTQVASHAQKY 163
                               8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.941468IPR017884SANT domain
SMARTSM007174.7E-111567IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-61765IPR009057Homeodomain-like
CDDcd001672.44E-91861No hitNo description
PfamPF002493.3E-91861IPR001005SANT/Myb domain
SuperFamilySSF466894.26E-121971IPR009057Homeodomain-like
PROSITE profilePS5129421.268112168IPR017930Myb domain
SuperFamilySSF466894.35E-17114169IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-17115167IPR006447Myb domain, plants
SMARTSM007177.3E-11116166IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-11116162IPR009057Homeodomain-like
CDDcd001677.64E-9119163No hitNo description
PfamPF002494.3E-12119163IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MMYTTNNHHR WILNNNSTWT RLEDKLFEQA LVMYPENDIE RWSKIARHVP GKTREDVMAH  60
YDALVHDVFE IDSGRVDPPS YPDDNSFELW EESSQDCNKQ ISFGSNKKSH DVERKKGTPW  120
TEEEHRLFLI GLDKYGKGDW RSISRNVVVT RTPTQVASHA QKYYLRQQSM KKERKRSSIH  180
DITTAVETNT VPPQNNLQSQ GGYQNFNFPM
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5389001e-113AJ538900.1 Nicotiana tabacum cDNA-AFLP-fragment BT2-M33-006.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618932.11e-125PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016459105.11e-125PREDICTED: transcription factor DIVARICATA-like
SwissprotQ9FNN61e-57SRM1_ARATH; Transcription factor SRM1
TrEMBLA0A1S3Z3U41e-124A0A1S3Z3U4_TOBAC; transcription factor DIVARICATA-like
STRINGXP_009618932.11e-124(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-72MYB family protein
Publications ? help Back to Top
  1. Wang T, et al.
    Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1027-41
    [PMID:26243618]
  2. Chen YS, et al.
    Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis.
    Plant Mol. Biol., 2017. 93(3): p. 299-311
    [PMID:27866313]