PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00689g00121.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB
Protein Properties Length: 380aa    MW: 43675.2 Da    PI: 6.7174
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00689g00121.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.59.4e-11173210139
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 
                               +g WT eEd +l+++v+++G + W+ Ia+++  gR +kq
  Peaxi162Scf00689g00121.1 173 KGQWTIEEDRILIHLVEKFGIRKWSQIAQMLK-GRIGKQ 210
                               799****************************9.**9997 PP

2Myb_DNA-binding31.54.2e-102122391645
                               HHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
           Myb_DNA-binding  16 vkqlGggtWktIartmgkgRtlkqcksrwq 45 
                               +++ G++ W+ Ia++++ gRt++++k++w+
  Peaxi162Scf00689g00121.1 212 HAEVGNK-WAEIAKRLP-GRTENSIKNHWN 239
                               7889***.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.302168227IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-13168210IPR009057Homeodomain-like
SMARTSM007172.8E-13172244IPR001005SANT/Myb domain
PfamPF002493.6E-9173210IPR001005SANT/Myb domain
SuperFamilySSF466892.1E-18173243IPR009057Homeodomain-like
CDDcd001672.69E-10176242No hitNo description
Gene3DG3DSA:1.10.10.603.0E-12211240IPR009057Homeodomain-like
PfamPF002491.3E-8212239IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MDDDFSINSK NYLQDFEHLD LNFSIPTFNN PDHNFMIETN SYDPFDPFSN IEDDLGDFNF  60
CYERKPFEEN IGASSSIVVN NIHGADEFSI NKENFMDVNM YNEKSFSSVC CEDVKPLNFV  120
VPDESSSCVT ADINGSCKEI GGRKSKKMKR NDNNLSSSMK KPSRGRKKSK SAKGQWTIEE  180
DRILIHLVEK FGIRKWSQIA QMLKGRIGKQ SHAEVGNKWA EIAKRLPGRT ENSIKNHWNA  240
TKRRQFSRRK CRTKWPRPSS LLQNYIKSLN LEKGSSKKNF HDTNPNAKVM KVSTKLEPVD  300
NFCQGNSIEQ VHDYGFSEVQ EFALDDKLFD DIPIGPSNMD DNIEKFMGLE MIPYELSTLV  360
QGEVNKEIDL MEMISRVNKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-221732454104C-Myb DNA-Binding Domain
1msf_C4e-221732454104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2192103e-71AC219210.1 Solanum lycopersicum chromosome 6 clone C06HBa0082B05, complete sequence.
GenBankAC2329443e-71AC232944.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 6 clone LE_HBa-24A16, complete sequence.
GenBankHG9755183e-71HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603629.11e-160PREDICTED: transcription factor MYB98-like
TrEMBLA0A1J6IMW21e-149A0A1J6IMW2_NICAT; Transcription factor myb98
STRINGXP_009603629.11e-159(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31502349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-50myb domain protein 98