PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00485g00916.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 190aa MW: 21719.9 Da PI: 10.5553 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.5 | 1.5e-18 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+++++ +G+g+W++ ++ g+ R++k+c++rw +yl Peaxi162Scf00485g00916.1 15 KGPWTPEEDLKLIQYIEVHGPGNWRSLPKNAGLQRCGKSCRLRWTNYL 62 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.9 | 2e-17 | 68 | 112 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rgr++ eE+e +++++ lG++ W++Ia++++ gRt++++k++w+++ Peaxi162Scf00485g00916.1 68 RGRFSFEEEETIIQLHSVLGNK-WSAIAARLP-GRTDNEIKNYWNTH 112 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.5E-26 | 7 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.331 | 10 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.47E-32 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.3E-15 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-17 | 15 | 62 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.10E-12 | 17 | 62 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.7E-27 | 66 | 117 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 20.342 | 67 | 117 | IPR017930 | Myb domain |
SMART | SM00717 | 4.8E-16 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.0E-16 | 68 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.54E-12 | 70 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MGRSPITSDK SGLKKGPWTP EEDLKLIQYI EVHGPGNWRS LPKNAGLQRC GKSCRLRWTN 60 YLRPDIKRGR FSFEEEETII QLHSVLGNKW SAIAARLPGR TDNEIKNYWN THIRKRLLRM 120 GLDPVTHSPR LDLLDLSSLF NSTQLNLSSL LGLQALVNPQ FLRLATTLLT SHTENNQEML 180 LQRLQANPTV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-30 | 13 | 117 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015170575.1 | 1e-117 | PREDICTED: transcription factor MYB39-like | ||||
Swissprot | Q9LDR8 | 1e-91 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | M1CJ44 | 1e-116 | M1CJ44_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400068481 | 1e-116 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G05100.1 | 3e-86 | myb domain protein 74 |
Publications ? help Back to Top | |||
---|---|---|---|
|