PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00418g00083.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 147aa MW: 16808.9 Da PI: 6.9437 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 42.7 | 1.3e-13 | 21 | 79 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+++N+e+ArrsR RK++ + L+ v +L+ +N + ++++ ++ + ++++e+ Peaxi162Scf00418g00083.1 21 RKRKRMISNKESARRSRMRKQKHVNDLTVQVNQLKDQNNQILTNINMVTQAYLNVEAEN 79 6789**********************************************999998887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 9.8E-12 | 11 | 70 | No hit | No description |
SMART | SM00338 | 9.0E-17 | 17 | 81 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.231 | 19 | 82 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.7E-10 | 21 | 72 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.44E-12 | 21 | 73 | No hit | No description |
CDD | cd14702 | 2.72E-18 | 22 | 72 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 24 | 39 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MASLSGTSSG SDDIQQLMDQ RKRKRMISNK ESARRSRMRK QKHVNDLTVQ VNQLKDQNNQ 60 ILTNINMVTQ AYLNVEAENS ILKAQMAELS HRLRSLNEII NCLNSTNYAA TTVEDPEVNC 120 EDDFLNPWNL LHVNHPIMAS ADAFNMY |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 20 | 41 | RKRKRMISNKESARRSRMRKQK |
2 | 33 | 40 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the DNA sequence 5'-ACTCAT-3' in target gene promoters. Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879). Positively regulates the expression of ASN1 and POX2/PRODH2 genes, which are involved in amino acid metabolism (PubMed:18088315). Regulates several metabolic pathways such as myo-inositol, raffinose and trehalose. Regulates several trehalose metabolism genes, including TRE1, TPP5 and TPP6 (PubMed:21534971). Mediates recruitment of the histone acetylation machinery to activate auxin-induced transcription. Interacts with ADA2B adapter protein to promote ADA2B-mediated recruitment of SAGA-like histone acetyltransferase complexes to specific auxin-responsive genes (PubMed:24861440). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:18088315, ECO:0000269|PubMed:21534971, ECO:0000269|PubMed:24861440}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By light (PubMed:9620274). Induced by hypoosmolarity (PubMed:15047879). Repressed by sucrose (at protein level) (PubMed:9721683, PubMed:15208401). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:15208401, ECO:0000269|PubMed:9620274, ECO:0000269|PubMed:9721683}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009800919.1 | 1e-77 | PREDICTED: ocs element-binding factor 1-like | ||||
Refseq | XP_016449664.1 | 1e-77 | PREDICTED: bZIP transcription factor 53-like | ||||
Swissprot | O65683 | 1e-41 | BZP11_ARATH; bZIP transcription factor 11 | ||||
TrEMBL | A0A1S3YC33 | 3e-76 | A0A1S3YC33_TOBAC; bZIP transcription factor 53-like | ||||
TrEMBL | A0A1U7YNV3 | 3e-76 | A0A1U7YNV3_NICSY; ocs element-binding factor 1-like | ||||
STRING | XP_009800919.1 | 4e-77 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA537 | 24 | 123 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G34590.1 | 4e-44 | G-box binding factor 6 |