PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00342g00113.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB
Protein Properties Length: 537aa    MW: 57991.3 Da    PI: 5.186
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00342g00113.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-173784148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              +g+WT  Ed +lv++v ++G g+W+++ ++ g+ R++k+c++rw ++l
  Peaxi162Scf00342g00113.1 37 KGPWTSAEDAILVEYVMKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 84
                              79******************************************9986 PP

2Myb_DNA-binding491.4e-1590133146
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               +g++T eE+ l++++++++G++ W++ a++++ gRt++++k++w++
  Peaxi162Scf00342g00113.1  90 KGAFTLEEERLIIELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 133
                               799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.2343284IPR017930Myb domain
SuperFamilySSF466893.56E-3034131IPR009057Homeodomain-like
SMARTSM007177.2E-143686IPR001005SANT/Myb domain
PfamPF002491.9E-153784IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-243891IPR009057Homeodomain-like
CDDcd001672.73E-113984No hitNo description
PROSITE profilePS5129425.3585139IPR017930Myb domain
SMARTSM007174.3E-1689137IPR001005SANT/Myb domain
PfamPF002491.2E-1490133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-2592137IPR009057Homeodomain-like
CDDcd001678.13E-1292133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MSITSETDDW MTSKVDMDSP DEANGGGNVG GSLPLKKGPW TSAEDAILVE YVMKHGEGNW  60
NAVQKHSGLA RCGKSCRLRW ANHLRPDLKK GAFTLEEERL IIELHAKMGN KWARMAAELP  120
GRTDNEIKNY WNTRIKRLQR AGLPVYPPDI CFLASQNKQN EELAGLSSTD AQHPGLVATN  180
NFDIPPVEFK NLELNQLLCP PAHVEIPASS LLDIPASGFL AQVHSAPYSS TSLLSTVHPS  240
KRIRGSESMF SGSNGDLFLA SCQYQNGGSL IAQPLGFSSY NHNLTYDGQQ SFSNVIPGSH  300
APLNGNSSTS EPTWALKVEL PSLQNQTANW DSPSSPLHSL ESVDTLIQSP LAGHSESVSL  360
SPRNSGLLDA VLYGSQTMNS SKDNSNQAKE ETSADAVGNS CPDLLEKGWE TYGDPISPLS  420
RLPASVFTEC TPTTGNSLHE LQSTSRMPGE NGCNVKQENA DQAPSDGKDD MLNQTIFASN  480
CSSPKTQHTK NNLALKNAFG SGFFDDYGWD CKQVHSVATS SGQACGRDSA WDAMSAM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-32351375106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015158629.10.0PREDICTED: transcription factor GAMYB-like isoform X1
TrEMBLA0A4D6FBN60.0A0A4D6FBN6_PETHY; MYB33b
STRINGPGSC0003DMT4000584260.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20212358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.17e-87myb domain protein 33