PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00304g00074.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 258aa MW: 30272.6 Da PI: 8.5801 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 42.3 | 1.7e-13 | 8 | 53 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede l+ +v ++G+++W++I++ + ++t+kqck rw+ +l Peaxi162Scf00304g00074.1 8 GVWKNTEDEVLKALVMKYGKNHWARISSLLV-HKTAKQCKARWYEWL 53 78*****************************.************986 PP | |||||||
2 | Myb_DNA-binding | 23.9 | 9.8e-08 | 61 | 103 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT Ede+l+++ +++++ W+tIa +g t+ qc r+ k+l Peaxi162Scf00304g00074.1 61 EWTRKEDEKLLHLANLMPSQ-WRTIAPVVG--HTPSQCLVRYEKLL 103 6*******************.********8..9******9999986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.863 | 1 | 57 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.5E-18 | 5 | 56 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-14 | 6 | 55 | IPR001005 | SANT/Myb domain |
Pfam | PF13921 | 2.6E-13 | 10 | 70 | No hit | No description |
CDD | cd00167 | 8.93E-11 | 10 | 53 | No hit | No description |
SuperFamily | SSF46689 | 5.08E-19 | 33 | 108 | IPR009057 | Homeodomain-like |
CDD | cd11659 | 2.66E-24 | 55 | 104 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.8E-11 | 57 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.0E-7 | 58 | 105 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 11.857 | 58 | 107 | IPR017930 | Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 258 aa Download sequence Send to blast |
MKVLIKGGVW KNTEDEVLKA LVMKYGKNHW ARISSLLVHK TAKQCKARWY EWLDPSIKKI 60 EWTRKEDEKL LHLANLMPSQ WRTIAPVVGH TPSQCLVRYE KLLDDNENYD LSDDDPRKLR 120 PGEIDPNPES RPACPDPDDM EEDEKEMLFE AWARLANARG KKAKRKSREK QQLEEARRLA 180 SLQERRELRA AGLIDVHQRK RKRSGIDYNA EIPFEKKPPP GFYDVTDEEC TVGLQPKFPY 240 TIEELEGERR VDKEARLR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5mqf_L | 1e-104 | 2 | 258 | 3 | 260 | Cell division cycle 5-like protein |
5xjc_L | 1e-104 | 2 | 258 | 3 | 260 | Cell division cycle 5-like protein |
5yzg_L | 1e-104 | 2 | 258 | 3 | 260 | Cell division cycle 5-like protein |
5z56_L | 1e-104 | 2 | 258 | 3 | 260 | Cell division cycle 5-like protein |
5z57_L | 1e-104 | 2 | 258 | 3 | 260 | Cell division cycle 5-like protein |
5z58_L | 1e-104 | 2 | 258 | 3 | 260 | Cell division cycle 5-like protein |
6ff4_L | 1e-104 | 2 | 258 | 3 | 260 | Cell division cycle 5-like protein |
6ff7_L | 1e-104 | 2 | 258 | 3 | 260 | Cell division cycle 5-like protein |
6icz_L | 1e-104 | 2 | 258 | 3 | 260 | Cell division cycle 5-like protein |
6id0_L | 1e-104 | 2 | 258 | 3 | 260 | Cell division cycle 5-like protein |
6id1_L | 1e-104 | 2 | 258 | 3 | 260 | Cell division cycle 5-like protein |
6qdv_O | 1e-104 | 2 | 258 | 3 | 260 | Cell division cycle 5-like protein |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019192775.1 | 1e-135 | PREDICTED: cell division cycle 5-like protein isoform X1 | ||||
Refseq | XP_019232628.1 | 1e-137 | PREDICTED: cell division cycle 5-like protein | ||||
Swissprot | P92948 | 1e-126 | CDC5L_ARATH; Cell division cycle 5-like protein | ||||
TrEMBL | A0A1J6HZR4 | 1e-134 | A0A1J6HZR4_NICAT; Cell division cycle 5-like protein (Fragment) | ||||
TrEMBL | A7UP12 | 1e-134 | A7UP12_SOLLC; CDC5-like protein | ||||
STRING | Solyc04g009950.2.1 | 1e-134 | (Solanum lycopersicum) | ||||
STRING | PGSC0003DMT400029953 | 1e-134 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6139 | 24 | 31 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09770.1 | 1e-110 | cell division cycle 5 |
Publications ? help Back to Top | |||
---|---|---|---|
|