PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00228g00914.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB
Protein Properties Length: 339aa    MW: 38901.9 Da    PI: 7.482
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00228g00914.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.7e-183582148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              rg+WT eEd  l ++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Peaxi162Scf00228g00914.1 35 RGPWTVEEDFALMNYIAHHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 82
                              89********************************************97 PP

2Myb_DNA-binding51.22.9e-1688131146
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Peaxi162Scf00228g00914.1  88 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 131
                               7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.3293086IPR017930Myb domain
SuperFamilySSF466893.74E-3132129IPR009057Homeodomain-like
SMARTSM007172.1E-143484IPR001005SANT/Myb domain
PfamPF002499.4E-163582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-223689IPR009057Homeodomain-like
CDDcd001672.37E-113782No hitNo description
SMARTSM007171.3E-1487135IPR001005SANT/Myb domain
PROSITE profilePS5129418.70787137IPR017930Myb domain
PfamPF002495.9E-1588131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-2390136IPR009057Homeodomain-like
CDDcd001672.12E-7108131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDHHHHVKVG SSHGGGANCN KNNQQQHDED MDLRRGPWTV EEDFALMNYI AHHGEGRWNS  60
LARCAGLKRT GKSCRLRWLN YLRPDVRRGN ITLEEQLLIL ELHSRWGNRW SKIAQHLPGR  120
TDNEIKNYWR TRVQKHAKQL KCDVNSKQFK DTMRYLWMPR LVERIQAAAA NNTTNSNNPS  180
KSQMVHQTIN SNMSGMSEFV PIHDNVVSTN KPRLMSTENS STAAASSENS FGTQVSPVNS  240
DLTDCCYNYP PVNQDYFQVS HHQSTTNNDQ LCHGESLTSP TGYFHHGTGL DQFQGMDQQQ  300
NMNSSQWMDG GNNFSDSLWN IDDMWFLQQQ LNNNNNNIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-243212924120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt (NaCl). {ECO:0000269|PubMed:16463103}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019253478.11e-158PREDICTED: transcription factor MYB108-like
SwissprotQ9FGY32e-96MYB78_ARATH; Transcription factor MYB78
TrEMBLA0A1J6IUC81e-156A0A1J6IUC8_NICAT; Transcription factor myb108
STRINGXP_009612140.11e-155(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.16e-89myb domain protein 78
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]