PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00175g00528.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 157aa MW: 17404.6 Da PI: 8.8552 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 101.6 | 1.6e-31 | 56 | 141 | 76 | 163 |
YABBY 76 kveeenlksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknW 160 +++++l+ ++ + ++ ss++ s++++ +p++p v++PPek+ r Psaynrf+keeiqrika+nP+i hreafsaaaknW Peaxi162Scf00175g00528.1 56 LDHHTSLQGFSSEFKIGQS--SSSTSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNW 138 4444444444443333333..333346778888999999********************************************** PP YABBY 161 ahf 163 a + Peaxi162Scf00175g00528.1 139 ARY 141 *75 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 2.9E-31 | 56 | 141 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 6.55E-9 | 85 | 139 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 2.4E-5 | 95 | 140 | IPR009071 | High mobility group box domain |
CDD | cd01390 | 3.21E-6 | 102 | 138 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MNSSHPAGSC SMDLVQSSEH FCYVLHLVLL YVSVSVNLFF LQFNNNARPP LQGQCLDHHT 60 SLQGFSSEFK IGQSSSSTSS TSSEPLSPKA PFVVKPPEKK HRLPSAYNRF MKEEIQRIKA 120 ANPEIPHREA FSAAAKNWAR YIPNAPNVSL SESSNNV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ739883 | 0.0 | KJ739883.1 Petunia axillaris subsp. axillaris CRC2 (CRC2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002263611.1 | 3e-62 | PREDICTED: protein CRABS CLAW isoform X2 | ||||
Swissprot | Q76EJ0 | 6e-35 | YABDL_ORYSJ; Protein DROOPING LEAF | ||||
TrEMBL | A0A075M8X6 | 3e-74 | A0A075M8X6_PETAX; CRC2 | ||||
STRING | VIT_01s0011g00140.t01 | 4e-61 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5210 | 23 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69180.1 | 9e-33 | YABBY family protein |