PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00171g00047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB
Protein Properties Length: 248aa    MW: 29114.3 Da    PI: 8.5968
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00171g00047.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-18449147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              rg W + Ede+l ++v+++G+++W++Ia+ ++ gR++k+c++rw++ 
  Peaxi162Scf00171g00047.1  4 RGHWRPHEDEKLRELVAKYGPHNWNAIAENLQ-GRSGKSCRLRWYNQ 49
                              899*****************************.************96 PP

2Myb_DNA-binding54.42.8e-175699146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                              r ++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Peaxi162Scf00171g00047.1 56 RSPFTEEEEERLLASHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99
                              789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.281154IPR017930Myb domain
SMARTSM007171.3E-16352IPR001005SANT/Myb domain
PfamPF002499.6E-18450IPR001005SANT/Myb domain
SuperFamilySSF466891.61E-29497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-27557IPR009057Homeodomain-like
CDDcd001679.14E-15748No hitNo description
SMARTSM007172.4E-1555103IPR001005SANT/Myb domain
PROSITE profilePS5129421.5555105IPR017930Myb domain
PfamPF002494.5E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.2E-2158104IPR009057Homeodomain-like
CDDcd001672.83E-115898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MCSRGHWRPH EDEKLRELVA KYGPHNWNAI AENLQGRSGK SCRLRWYNQL DPRINRSPFT  60
EEEEERLLAS HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MSRRCRERSK IYSMRNINNS  120
AQNSTTSPQD TSQNTRRGSP NMNSIDQQLL GRFNYYPNLT FNNSLYPKEL YFDHLRHHLK  180
INEDKNQEVE CYDFLRVNTG SNKSEVIDHI ARKGTDDEEV EQEAGYHYPA QSKAPVQFID  240
FLSVGDSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-3441057108B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616250.11e-139PREDICTED: transcriptional activator Myb-like
RefseqXP_016466774.11e-139PREDICTED: transcriptional activator Myb-like
RefseqXP_018630632.11e-139PREDICTED: transcriptional activator Myb-like
SwissprotQ6R0C41e-76MYB52_ARATH; Transcription factor MYB52
TrEMBLA0A1S3ZR421e-138A0A1S3ZR42_TOBAC; transcriptional activator Myb-like
STRINGXP_009616250.11e-139(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.15e-79myb domain protein 52
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Cassan-Wang H, et al.
    Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis.
    Front Plant Sci, 2013. 4: p. 189
    [PMID:23781226]
  3. Shi D, et al.
    MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage.
    Plant Physiol., 2018. 176(4): p. 2737-2749
    [PMID:29440562]