PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00159g00167.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRAS
Protein Properties Length: 579aa    MW: 63354.2 Da    PI: 4.8335
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00159g00167.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS445.43.8e-1361995761374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               lv++L++cAea+++++++la+alL+++  la +++ +m+++a+yf+eALa++++r        l p++ ++  s+ +   +  f+
  Peaxi162Scf00159g00167.1 199 LVHTLMACAEAIQQDNFKLAEALLKQIGFLAVSQAGAMRKVATYFAEALARKIYR--------LYPTNPND--SAFTDLLQMHFY 273
                               689****************************************************........44555543..4444444446** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                               e++P+lkf+h+taNqaIlea+ g+++vH+iDf+++qG+QWpaLlqaLa Rp+g+p++R+Tg+g+p++++++ l+e+g++La++A+
  Peaxi162Scf00159g00167.1 274 ETCPYLKFAHFTANQAILEAFTGKSKVHVIDFSMKQGMQWPALLQALALRPAGAPTFRLTGIGPPAHDNTDHLQEVGWKLAQLAD 358
                               ************************************************************************************* PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                               +++v+fef+ +va++++dl+  ++++++gE++aVn++++lh ll++++ +e+    vL++vk+++P++++vveqea+hn++ F +
  Peaxi162Scf00159g00167.1 359 SINVEFEFRGFVANSIADLNAAMFDIREGETVAVNSIFELHPLLARPGGVEK----VLSFVKDMKPEIFTVVEQEANHNGPGFID 439
                               ***************************************************9....***************************** PP

                      GRAS 256 rflealeyysalfdsleak.................lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaG 323
                               rf+e+l+yys+lfdsle                   l++ s++++++++++lgr+i nvvaceg +r+erhetl++Wr r+++ G
  Peaxi162Scf00159g00167.1 440 RFTESLHYYSTLFDSLEGCgvgggaggggaggvggeLGPVSDQDKMMSEVYLGRQILNVVACEGVDRVERHETLAQWRTRFNSGG 524
                               ****************9888***************************************************************** PP

                      GRAS 324 Fkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               F+pv+l+++a kqa++ll+ ++ + gyrvee++g+l+lgW++rpL+++SaW+
  Peaxi162Scf00159g00167.1 525 FEPVHLGSNAFKQASMLLALFAgGGGYRVEENNGCLMLGWHTRPLIATSAWK 576
                               **********************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120417.0E-3442108IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.9E-3342115No hitNo description
PROSITE profilePS5098566.546173555IPR005202Transcription factor GRAS
PfamPF035141.3E-133199576IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MKRNQNQTTS YQQQEQETNN SSSSNTGKAK MWEQEQQDAG VDELLAVLGY KVKASDMAEV  60
ASKLEQLEQV MGSVQQDNLS FLASETVHYN PSDLSSWLES MISEFNPHDP FTPSTNHNDK  120
TNIVYDDSSF DSDLTAIPGK ALLSQIEPES KRFKMEISSS SSSLSVDSTM WGSAGTPLPE  180
STTTRPVVLV DSQDNGVRLV HTLMACAEAI QQDNFKLAEA LLKQIGFLAV SQAGAMRKVA  240
TYFAEALARK IYRLYPTNPN DSAFTDLLQM HFYETCPYLK FAHFTANQAI LEAFTGKSKV  300
HVIDFSMKQG MQWPALLQAL ALRPAGAPTF RLTGIGPPAH DNTDHLQEVG WKLAQLADSI  360
NVEFEFRGFV ANSIADLNAA MFDIREGETV AVNSIFELHP LLARPGGVEK VLSFVKDMKP  420
EIFTVVEQEA NHNGPGFIDR FTESLHYYST LFDSLEGCGV GGGAGGGGAG GVGGELGPVS  480
DQDKMMSEVY LGRQILNVVA CEGVDRVERH ETLAQWRTRF NSGGFEPVHL GSNAFKQASM  540
LLALFAGGGG YRVEENNGCL MLGWHTRPLI ATSAWKLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-6220657526378Protein SCARECROW
5b3h_A3e-6220657525377Protein SCARECROW
5b3h_D3e-6220657525377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009789076.10.0PREDICTED: DELLA protein GAI1-like
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A1U7XHE40.0A0A1U7XHE4_NICSY; DELLA protein GAI1-like
STRINGXP_009789076.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein