PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00146g01325.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 140aa MW: 15581.7 Da PI: 5.2898 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 157.2 | 2.7e-49 | 28 | 119 | 2 | 93 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 reqdr+lPian+srimkk++P n+ki+kdak+ vqecvsefisf+tseasdkcqre+rkting dll a+ lGfedy++plk++ Peaxi162Scf00146g01325.1 28 REQDRLLPIANISRIMKKAIPPNGKIAKDAKDAVQECVSEFISFITSEASDKCQRERRKTINGYDLLLAMLALGFEDYIDPLKMF 112 89*********************************************************************************** PP NF-YB 87 lkkyrel 93 l +y e Peaxi162Scf00146g01325.1 113 LDRYTER 119 ****885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 6.5E-47 | 25 | 122 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.81E-35 | 30 | 123 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.8E-26 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.5E-16 | 61 | 79 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.5E-16 | 80 | 98 | No hit | No description |
PRINTS | PR00615 | 2.5E-16 | 99 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MADGQQGSAN SHESDEHSPP PIGSKNIREQ DRLLPIANIS RIMKKAIPPN GKIAKDAKDA 60 VQECVSEFIS FITSEASDKC QRERRKTING YDLLLAMLAL GFEDYIDPLK MFLDRYTERL 120 TKAADGSIER EGMLPTPTSQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-43 | 27 | 118 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-43 | 27 | 118 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010326024.1 | 9e-62 | nuclear transcription factor Y subunit B-10 isoform X2 | ||||
Swissprot | Q5QMG3 | 6e-55 | NFYB2_ORYSJ; Nuclear transcription factor Y subunit B-2 | ||||
TrEMBL | A0A3Q7HVS9 | 2e-60 | A0A3Q7HVS9_SOLLC; Uncharacterized protein | ||||
STRING | XP_009767971.1 | 3e-60 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA25100 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38880.7 | 2e-54 | nuclear factor Y, subunit B1 |