PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00071g00098.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRAS
Protein Properties Length: 473aa    MW: 53510.7 Da    PI: 6.3652
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00071g00098.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS412.44.1e-126464681374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               lv+lL++c+++v++g+ e a+    r+ +la+pdgd+mqR+aayfteALa r+++ +++l +al++++ +    +ee  ++klf+
  Peaxi162Scf00071g00098.1  46 LVHLLVTCVNHVATGNIESANIGFDRIAHLAAPDGDSMQRIAAYFTEALADRMLKGWPGLHRALNSTKLA--CLAEESLVQKLFF 128
                               68**************************************************************999998..599999******* PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                               e++P+l+++++++N+aI+ea+ege+ vHiiD++  +++QW++Llq++++Rpegpp+lRiTg+++    +k+ le+++++L++ Ae
  Peaxi162Scf00071g00098.1 129 ELCPFLRLAYVITNEAIMEAMEGEKVVHIIDLNSFEPAQWINLLQSMSARPEGPPHLRITGIHE----HKHVLEQMAHQLNEEAE 209
                               ****************************************************************....9**************** PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll......................................... 214
                               +l++pf+fn+ ++++le+le+ +L+vk+gEalaV++vlqlh ll                                         
  Peaxi162Scf00071g00098.1 210 KLDIPFQFNP-IVSKLENLEIGSLNVKTGEALAVSSVLQLHCLLafddemlqkntplvskstnsvhlqrmlqvsprtlgdflekd 293
                               **********.7999********************************************************************** PP

                      GRAS 215 ...............desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                                               +s+ ++ +  ++L+ +++lsPk+++++eqe++hn+  ++er +eal++y+alfd+le+  +r+s er+k
  Peaxi162Scf00071g00098.1 294 vpnsygaspdsslasPQSLVTAPKMMNFLNGLWNLSPKIMIMTEQESNHNGLCLMERTMEALNFYAALFDCLESREARTSIERQK 378
                               *********999976333334446999************************************************9********* PP

                      GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                               +E++l g+ei+n+++ceg er+ rhe+lekW  rle aGF+ v+l+ +++ q  +llr ++ dg+++++++g+++++W+d+pL+s
  Peaxi162Scf00071g00098.1 379 IEKMLYGEEIKNILSCEGLERKRRHEKLEKWIPRLEFAGFGRVRLNFHIMLQGMRLLRSHNYDGFKIKDQDGCFLICWQDQPLFS 463
                               ************************************************************************************* PP

                      GRAS 370 vSaWr 374
                               vSaWr
  Peaxi162Scf00071g00098.1 464 VSAWR 468
                               ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.73420448IPR005202Transcription factor GRAS
PfamPF035141.4E-12346468IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MGQEEGSSSV SSSPLQFFSM MSLSPGIGSP HPWLGEMRSE QRGLCLVHLL VTCVNHVATG  60
NIESANIGFD RIAHLAAPDG DSMQRIAAYF TEALADRMLK GWPGLHRALN STKLACLAEE  120
SLVQKLFFEL CPFLRLAYVI TNEAIMEAME GEKVVHIIDL NSFEPAQWIN LLQSMSARPE  180
GPPHLRITGI HEHKHVLEQM AHQLNEEAEK LDIPFQFNPI VSKLENLEIG SLNVKTGEAL  240
AVSSVLQLHC LLAFDDEMLQ KNTPLVSKST NSVHLQRMLQ VSPRTLGDFL EKDVPNSYGA  300
SPDSSLASPQ SLVTAPKMMN FLNGLWNLSP KIMIMTEQES NHNGLCLMER TMEALNFYAA  360
LFDCLESREA RTSIERQKIE KMLYGEEIKN ILSCEGLERK RRHEKLEKWI PRLEFAGFGR  420
VRLNFHIMLQ GMRLLRSHNY DGFKIKDQDG CFLICWQDQP LFSVSAWRIQ RYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-36464684375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019185670.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_019185679.10.0PREDICTED: scarecrow-like protein 3
RefseqXP_019185686.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A438GU360.0A0A438GU36_VITVI; Scarecrow-like protein 3
TrEMBLF6GX840.0F6GX84_VITVI; Uncharacterized protein
STRINGVIT_13s0019g01220.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]