PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00066g01813.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB
Protein Properties Length: 321aa    MW: 36736.6 Da    PI: 10.4077
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00066g01813.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-181762147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              rg W + Ede+l ++v+q+G+ +W++Ia++++ gR++k+c++rw++ 
  Peaxi162Scf00066g01813.1 17 RGHWRPAEDERLRQLVEQYGPQNWNSIAEKLQ-GRSGKSCRLRWFNQ 62
                              899*****************************.***********996 PP

2Myb_DNA-binding57.23.8e-1869113147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               r ++T++E+e+l+ a++ +G++ W++I+r ++ gRt++ +k++w+ +
  Peaxi162Scf00066g01813.1  69 RRPFTEDEEERLLAAHRVHGNK-WALISRLFP-GRTDNAVKNHWHVL 113
                               679*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.0921263IPR017930Myb domain
SuperFamilySSF466891.98E-2915110IPR009057Homeodomain-like
SMARTSM007179.5E-151665IPR001005SANT/Myb domain
PfamPF002491.5E-171762IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-271870IPR009057Homeodomain-like
CDDcd001671.16E-132061No hitNo description
PROSITE profilePS5129427.59764118IPR017930Myb domain
SMARTSM007172.8E-1568116IPR001005SANT/Myb domain
PfamPF002496.2E-1569113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2071117IPR009057Homeodomain-like
CDDcd001671.36E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MAEGGGSGDD TRSSCPRGHW RPAEDERLRQ LVEQYGPQNW NSIAEKLQGR SGKSCRLRWF  60
NQLDPRINRR PFTEDEEERL LAAHRVHGNK WALISRLFPG RTDNAVKNHW HVLMARKQRE  120
QSKICGKRSY PQDNFLSDSK SPSYGFRRRN NNNNNTNIPK TQEGYNYGTK FSLFEFQNPT  180
KDRVFSVSTY SSSPSWNSPD QLFRRNGSHL LKESSNFSGQ KSLCQNNLSF STHGGGGATL  240
FPVPNNYKKT TARNPFSYSN NGSDGMTEKV MNISNSTFSF NKILRASIEQ QRRQQQQQHA  300
EEAIEKKDIP FIDFLGVGIS S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30171177107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-42HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597907.11e-170PREDICTED: myb-related protein B-like
RefseqXP_016438115.11e-170PREDICTED: myb-related protein B-like
TrEMBLA0A1S3XE421e-168A0A1S3XE42_TOBAC; myb-related protein B-like
STRINGXP_009597907.11e-169(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.12e-66myb domain protein 52