PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00062g00073.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRAS
Protein Properties Length: 468aa    MW: 52551.2 Da    PI: 6.2404
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00062g00073.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS471.16e-144474651374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               l++lLl+cA++v+sg+le+a+ +L ++s+laspdgd+mqR+a+yf eALa r++rs+++lykal++++ s   +se + ++k+f+
  Peaxi162Scf00062g00073.1  47 LIHLLLACANHVASGSLENANIALDHISHLASPDGDTMQRIASYFSEALADRILRSWPGLYKALRSTKLS--VVSEDILVRKMFF 129
                               689*************************************************************999998..69*********** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                               e +P+lk++++++NqaI ea+ege++vHi+D+++ ++lQW aLlq L++Rpegpp+lRiTgv++    +ke l ++++ L++ Ae
  Peaxi162Scf00062g00073.1 130 EFFPFLKVAFVVTNQAIIEAMEGEKMVHIVDLNAAEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKEVLDQMAHVLTEEAE 210
                               ****************************************************************....9**************** PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll......................................... 214
                               +l++pf+fn+ v+++le+l++e+Lrvk+gEala+++vlqlh+ll                                         
  Peaxi162Scf00062g00073.1 211 KLDIPFQFNA-VVSKLENLDVEKLRVKTGEALAISSVLQLHTLLahddekksplpfkhsngvhlqralinkntlgellekdvang 294
                               **********.799*********************************************************************** PP

                      GRAS 215 .........desvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                                        +++++++s  + d++L ++++lsPkv+vv+eq+++hn+++++er++e+l+yy+alfd+le++lpr+s er k+E++
  Peaxi162Scf00062g00073.1 295 yspsndtasSSPLCSTSstKMDSLLIALWGLSPKVMVVTEQDSNHNGTTLMERLSESLHYYAALFDCLESTLPRTSLERLKMENM 379
                               *******9844443333445789************************************************************** PP

                      GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                               l+g+ei+n++aceg er+erhe+lekW +r++ aGF++vpls++a+ qa++ll+ ++ +gy+++e++gs+v +W+dr+L+svS+W
  Peaxi162Scf00062g00073.1 380 LFGEEIKNIIACEGIERKERHEKLEKWFQRFDPAGFGNVPLSYYAMLQARRLLQSYSCEGYKIKEDNGSVVVCWQDRALFSVSSW 464
                               ************************************************************************************* PP

                      GRAS 374 r 374
                               r
  Peaxi162Scf00062g00073.1 465 R 465
                               8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.33921445IPR005202Transcription factor GRAS
PfamPF035142.1E-14147465IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MIQDDGSSSV TSSSPLQIFP IMSLSPGFGS SNQWLKELKS EERGLYLIHL LLACANHVAS  60
GSLENANIAL DHISHLASPD GDTMQRIASY FSEALADRIL RSWPGLYKAL RSTKLSVVSE  120
DILVRKMFFE FFPFLKVAFV VTNQAIIEAM EGEKMVHIVD LNAAEPLQWR ALLQDLSARP  180
EGPPHLRITG VHQQKEVLDQ MAHVLTEEAE KLDIPFQFNA VVSKLENLDV EKLRVKTGEA  240
LAISSVLQLH TLLAHDDEKK SPLPFKHSNG VHLQRALINK NTLGELLEKD VANGYSPSND  300
TASSSPLCST SSTKMDSLLI ALWGLSPKVM VVTEQDSNHN GTTLMERLSE SLHYYAALFD  360
CLESTLPRTS LERLKMENML FGEEIKNIIA CEGIERKERH EKLEKWFQRF DPAGFGNVPL  420
SYYAMLQARR LLQSYSCEGY KIKEDNGSVV VCWQDRALFS VSSWRCKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-40294641378Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015061792.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A3Q7JDZ10.0A0A3Q7JDZ1_SOLLC; Uncharacterized protein
STRINGSolyc12g099900.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]