PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00059g00113.1
Organism
Petunia axillaris
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family SBP
Protein Properties Length: 139aa    MW: 16155 Da    PI: 9.6228
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00059g00113.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.66.6e-4251127177
                               --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                       SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                               +Cq+e+C+adls+ak+yh+rhkvCe h+ka+vv+v+gl+qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++
  Peaxi162Scf00059g00113.1  51 CCQAEKCTADLSDAKQYHKRHKVCEYHAKAQVVFVTGLRQRFCQQCSRFHELGEFDESKRSCRRRLAGHNERRRKSS 127
                               6**************************************************************************87 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375752.4E-571138IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.102.0E-3344113IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.94949126IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-3850131IPR004333Transcription factor, SBP-box
PfamPF031109.0E-3252125IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009908Biological Processflower development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MEAMEGEVHL EDNDLLILST NDDDKKKRTR NNRTNDKKGS YNNGGSSSMR CCQAEKCTAD  60
LSDAKQYHKR HKVCEYHAKA QVVFVTGLRQ RFCQQCSRFH ELGEFDESKR SCRRRLAGHN  120
ERRRKSSSST TENNQLPRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-4042125184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2606352e-88KP260635.1 Nicotiana tabacum SBP-box 4 (SPL4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626190.11e-56PREDICTED: squamosa promoter-binding-like protein 4
RefseqXP_016462352.11e-56PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ9S7A91e-43SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLA0A2K9ZXU34e-98A0A2K9ZXU3_PETHY; Squamosa promoter-binding-like protein
STRINGXP_009626190.14e-56(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.17e-38squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Hyun Y, et al.
    Site-directed mutagenesis in Arabidopsis thaliana using dividing tissue-targeted RGEN of the CRISPR/Cas system to generate heritable null alleles.
    Planta, 2015. 241(1): p. 271-84
    [PMID:25269397]
  3. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]
  4. Ioannidi E, et al.
    Trichome patterning control involves TTG1 interaction with SPL transcription factors.
    Plant Mol. Biol., 2016. 92(6): p. 675-687
    [PMID:27631431]
  5. Jung JH,Lee HJ,Ryu JY,Park CM
    SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering.
    Mol Plant, 2016. 9(12): p. 1647-1659
    [PMID:27815142]