PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00050g00101.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family GRAS
Protein Properties Length: 467aa    MW: 52735.4 Da    PI: 6.5102
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00050g00101.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS471.54.5e-144494641374
                      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfs 85 
                               l++lLl+cA++v++g+le+a+ +L ++s+laspdgd+mqR+a+yf+eALa r++rs++++ykal++++ s   +se + + k+f+
  Peaxi162Scf00050g00101.1  49 LIHLLLTCANHVAAGSLENANIALDQISQLASPDGDTMQRIASYFAEALADRILRSWPGIYKALHSTKLS--VVSEDILVKKMFF 131
                               689*************************************************************999998..69*********** PP

                      GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAe 170
                               e +P+lk++ +++NqaI ea+ege++vHi+D+++s++lQW aLlq L++Rpegpp+lRiTgv++    +ke le++++ L++ Ae
  Peaxi162Scf00050g00101.1 132 EYFPFLKVASVITNQAIIEAMEGEKMVHIVDLNASEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKEVLEQIAHVLTEEAE 212
                               ****************************************************************....9**************** PP

                      GRAS 171 elgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll......................................... 214
                               +l++pf+f+  v+++le+l++e+Lr+k+gEala+++v+qlh+ll                                         
  Peaxi162Scf00050g00101.1 213 KLDIPFQFHQ-VVSKLENLDVEKLRIKTGEALAISSVMQLHTLLahdcehqkksplafkhlnghhlkralfnpnntlgellekdt 296
                               **********.799*********************************************************************** PP

                      GRAS 215 ..........desvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                                         +++       + d +L+++++lsPkv+vv+eq+++hn+++++er++e+l++y+alfd+le +l r+s er kvE+
  Peaxi162Scf00050g00101.1 297 gnesasssplSST----AsaKMDGFLHALWGLSPKVMVVTEQDSNHNGTTLMERLSESLYFYAALFDCLEFTLQRTSLERLKVEK 377
                               ****886653222....1335799************************************************************* PP

                      GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                               +l+g+ei+n+vaceg er+erhe+l kW +r++ aGF++vpls++a+ qa++ll+ +  +gy+++ee+g++v++W+dr+L+svSa
  Peaxi162Scf00050g00101.1 378 MLFGEEIKNIVACEGVERKERHEKLDKWFQRFDGAGFGNVPLSYYAMLQARRLLQSYTCEGYKIKEENGCVVICWQDRALFSVSA 462
                               ************************************************************************************* PP

                      GRAS 373 Wr 374
                               Wr
  Peaxi162Scf00050g00101.1 463 WR 464
                               *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.48323444IPR005202Transcription factor GRAS
PfamPF035141.6E-14149464IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MLQQDDGSSS VTSSSPLQNF PMMSLSPNFG GSPYHWLKEL KSEERGLYLI HLLLTCANHV  60
AAGSLENANI ALDQISQLAS PDGDTMQRIA SYFAEALADR ILRSWPGIYK ALHSTKLSVV  120
SEDILVKKMF FEYFPFLKVA SVITNQAIIE AMEGEKMVHI VDLNASEPLQ WRALLQDLSA  180
RPEGPPHLRI TGVHQQKEVL EQIAHVLTEE AEKLDIPFQF HQVVSKLENL DVEKLRIKTG  240
EALAISSVMQ LHTLLAHDCE HQKKSPLAFK HLNGHHLKRA LFNPNNTLGE LLEKDTGNES  300
ASSSPLSSTA SAKMDGFLHA LWGLSPKVMV VTEQDSNHNG TTLMERLSES LYFYAALFDC  360
LEFTLQRTSL ERLKVEKMLF GEEIKNIVAC EGVERKERHE KLDKWFQRFD GAGFGNVPLS  420
YYAMLQARRL LQSYTCEGYK IKEENGCVVI CWQDRALFSV SAWRCRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A6e-69324661380Protein SCARECROW
5b3h_D6e-69324661380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016505834.10.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A1S4CXT40.0A0A1S4CXT4_TOBAC; scarecrow-like protein 3
STRINGXP_009793219.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]