PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00013g00940.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 169aa MW: 19414.8 Da PI: 8.8335 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28.1 | 4.6e-09 | 8 | 57 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwqky 47 WT +E+ + +a++ + + +W +Ia +++ +t +++k ++q++ Peaxi162Scf00013g00940.1 8 VWTRDEERAFENAIAIMHSIeysnkeQWQKIALMVP-SKTIEELKQHYQML 57 6***************99889***************.************87 PP | |||||||
2 | Myb_DNA-binding | 41.8 | 2.4e-13 | 103 | 148 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++WT+eE+ l++ + +++G+g+W++I+r + Rt+ q+ s+ qky Peaxi162Scf00013g00940.1 103 LPWTAEEHRLFLLGLEEFGKGDWRSISRNFVISRTPSQVASHAQKY 148 69*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 7.86 | 1 | 62 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-6 | 5 | 60 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-4 | 7 | 58 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.2E-7 | 8 | 57 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.49E-7 | 9 | 58 | No hit | No description |
SuperFamily | SSF46689 | 2.3E-8 | 9 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.358 | 97 | 153 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.17E-16 | 99 | 154 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.2E-11 | 101 | 151 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 1.4E-16 | 101 | 151 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 3.4E-11 | 103 | 150 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.57E-10 | 104 | 149 | No hit | No description |
Pfam | PF00249 | 2.0E-11 | 104 | 148 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MPVSTSVVWT RDEERAFENA IAIMHSIEYS NKEQWQKIAL MVPSKTIEEL KQHYQMLVDD 60 VTAIDAGYVP IPNYTIVKAS SSTDESSHGY SGVSRNQERR KGLPWTAEEH RLFLLGLEEF 120 GKGDWRSISR NFVISRTPSQ VASHAQKYFN RLESNSRGRR RSSIHDITL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 2e-13 | 9 | 85 | 11 | 84 | RADIALIS |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019265953.1 | 5e-78 | PREDICTED: transcription factor DIVARICATA-like | ||||
Swissprot | Q9FNN6 | 3e-58 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A314L2D0 | 1e-76 | A0A314L2D0_NICAT; Transcription factor myb1r1 | ||||
STRING | XP_009616490.1 | 5e-77 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA24899 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G49010.1 | 2e-55 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|