PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Peaxi162Scf00002g00037.1

Organism

Petunia axillaris

Taxonomic ID

33119

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia

Family

MYB_related

Protein Properties

Length: 105aa MW: 12037.1 Da PI: 9.9698

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Peaxi162Scf00002g00037.1	genome	SGN	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.5	2.3e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ + G +W+++++ g++R++k+c++rw +yl Peaxi162Scf00002g00037.1 14 KGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.6E-22	5	62	IPR009057	Homeodomain-like
PROSITE profile	PS51294	20.113	9	65	IPR017930	Myb domain
SMART	SM00717	1.5E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-15	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	9.9E-19	15	88	IPR009057	Homeodomain-like
CDD	cd00167	2.65E-9	16	61	No hit	No description
PROSITE profile	PS50090	3.926	62	105	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	9.1E-6	63	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLISFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY 60 LRPDLKRGLL SDAEEKLVID LHSRLGNRSY DRVVQDCCKI TRKDG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	5e-15	14	88	4	77	MYB PROTO-ONCOGENE PROTEIN
1mse_C	5e-15	14	88	4	77	C-Myb DNA-Binding Domain
1msf_C	5e-15	14	88	4	77	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269\|PubMed:15805488}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JF793915	1e-146	JF793915.1 Petunia axillaris isolate N MYB transcription factor ODO1 (ODO1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021725517.1	3e-57	protein ODORANT1-like
Swissprot	Q50EX6	2e-59	ODO1_PETHY; Protein ODORANT1
TrEMBL	F5CSR7	2e-57	F5CSR7_PETAX; MYB transcription factor ODO1
TrEMBL	F5CSR8	2e-57	F5CSR8_PETAX; MYB transcription factor ODO1
TrEMBL	F5CSR9	2e-57	F5CSR9_9SOLA; MYB transcription factor ODO1
STRING	XP_009628634.1	3e-56	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G12350.1	3e-57	myb domain protein 42

Publications ? help Back to Top
Verdonk JC,Haring MA,van Tunen AJ,Schuurink RC ODORANT1 regulates fragrance biosynthesis in petunia flowers. Plant Cell, 2005. 17(5): p. 1612-24 [PMID:15805488]