PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_9818613g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 129aa MW: 15049.3 Da PI: 10.4618 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49 | 1.4e-15 | 19 | 66 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed++l +++k +G g+W +++ g++R++k+c++rw++yl MA_9818613g0010 19 RGAWTANEDKILSEYIKTHGVGRWGDLPKKAGLRRCGKSCRLRWLNYL 66 89*********************************************7 PP | |||||||
2 | Myb_DNA-binding | 56 | 9.2e-18 | 72 | 115 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ ++eEdellv+++++lG++ W++Ia +++ Rt++++k++w++ MA_9818613g0010 72 RGNISPEEDELLVRLHRLLGNR-WSLIAGRLP-SRTDNEIKNYWNT 115 7999******************.*********.***********98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.946 | 14 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.13E-29 | 17 | 113 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.0E-12 | 18 | 68 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-14 | 19 | 66 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.8E-23 | 20 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.36E-8 | 21 | 66 | No hit | No description |
PROSITE profile | PS51294 | 26.384 | 67 | 121 | IPR017930 | Myb domain |
SMART | SM00717 | 2.0E-16 | 71 | 119 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.7E-16 | 72 | 116 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-25 | 73 | 121 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.35E-11 | 76 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 129 aa Download sequence Send to blast |
MCRSPSCWSC SKHVDGLNRG AWTANEDKIL SEYIKTHGVG RWGDLPKKAG LRRCGKSCRL 60 RWLNYLRPDI KRGNISPEED ELLVRLHRLL GNRWSLIAGR LPSRTDNEIK NYWNTQLSKR 120 VQMGEFEPR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-27 | 17 | 121 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269|PubMed:15361138}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF810440 | 0.0 | JF810440.1 Picea abies TT2-like protein mRNA, complete cds. | |||
GenBank | KU131218 | 0.0 | KU131218.1 Picea abies transcription factor MYB29 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018499327.1 | 4e-62 | PREDICTED: transcription factor MYB32-like isoform X2 | ||||
Swissprot | Q9FJA2 | 1e-52 | TT2_ARATH; Transcription factor TT2 | ||||
TrEMBL | A0A167V8X0 | 4e-88 | A0A167V8X0_PICAB; Transcription factor MYB29 | ||||
STRING | XP_009361685.1 | 4e-61 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G35550.1 | 5e-55 | MYB family protein |