PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_9684426g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 135aa MW: 14927.9 Da PI: 10.7662 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.9 | 1.2e-18 | 24 | 69 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd l ++v++lG+++W++I++ ++ gR++k+c++rw + MA_9684426g0010 24 KGPWSPEEDASLQKLVEKLGPRNWSLISKGIP-GRSGKSCRLRWCNQ 69 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 55.7 | 1.1e-17 | 78 | 120 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++eEd + +a+ ++G++ W+tIar ++ gRt++ +k++w++ MA_9684426g0010 78 PFSPEEDRMIMEAHSMHGNK-WATIARILP-GRTDNAIKNHWNST 120 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.329 | 19 | 70 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.08E-32 | 22 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.3E-15 | 23 | 72 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-18 | 24 | 69 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.6E-26 | 25 | 77 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.12E-14 | 26 | 68 | No hit | No description |
PROSITE profile | PS51294 | 26.092 | 71 | 125 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-14 | 75 | 123 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.0E-15 | 78 | 120 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.87E-12 | 78 | 121 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.9E-24 | 78 | 124 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MAVGNTKAPG SESSGSGERG QRIKGPWSPE EDASLQKLVE KLGPRNWSLI SKGIPGRSGK 60 SCRLRWCNQL SPQVQHRPFS PEEDRMIMEA HSMHGNKWAT IARILPGRTD NAIKNHWNST 120 LRRKCLAEKD NSGGG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-42 | 23 | 125 | 3 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 1e-41 | 23 | 125 | 57 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 1e-41 | 23 | 125 | 57 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 3e-42 | 23 | 125 | 3 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 3e-42 | 23 | 125 | 3 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002272706.1 | 7e-62 | PREDICTED: myb-related protein B | ||||
Refseq | XP_008462845.1 | 1e-61 | PREDICTED: transcription factor MYB44-like | ||||
Swissprot | O23160 | 2e-57 | MYB73_ARATH; Transcription factor MYB73 | ||||
TrEMBL | A0A222UAA8 | 3e-72 | A0A222UAA8_GINBI; R2R3MYB7 | ||||
STRING | VIT_13s0067g01360.t01 | 3e-61 | (Vitis vinifera) | ||||
STRING | XP_008462845.1 | 6e-61 | (Cucumis melo) | ||||
STRING | EFJ23406 | 4e-62 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37260.1 | 1e-59 | myb domain protein 73 |
Publications ? help Back to Top | |||
---|---|---|---|
|