PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_962483g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 73aa MW: 8551.29 Da PI: 4.0835 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 32.3 | 2.3e-10 | 24 | 64 | 1 | 43 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 ++ ++++E++l+ ++ ++lG + W++Ia +++ gRt++++ + MA_962483g0010 24 KMVFSEDEEDLISRLYNLLGQR-WALIAGRIP-GRTAEEIEKY 64 5789*****************9.*********.*****99765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 1.5E-6 | 23 | 71 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-9 | 24 | 64 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.14E-7 | 25 | 65 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.00E-7 | 27 | 65 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.0E-11 | 27 | 64 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 73 aa Download sequence Send to blast |
MSDMDRSSSE DSVDSQDDVN ENYKMVFSED EEDLISRLYN LLGQRWALIA GRIPGRTAEE 60 IEKYCSRRYS SEY |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT112056 | 1e-121 | BT112056.1 Picea glauca clone GQ03309_F08 mRNA sequence. | |||
GenBank | EF678547 | 1e-121 | EF678547.1 Picea sitchensis clone WS02926_L15 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010923911.1 | 6e-28 | transcription factor CPC | ||||
TrEMBL | B8LRL3 | 3e-45 | B8LRL3_PICSI; Uncharacterized protein | ||||
STRING | XP_010267757.1 | 5e-27 | (Nelumbo nucifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP3921 | 8 | 25 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46410.1 | 6e-17 | MYB_related family protein |