![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_959414g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 146aa MW: 17101.6 Da PI: 7.5955 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 181.6 | 5.6e-56 | 1 | 144 | 230 | 374 |
GRAS 230 lvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGF 324 ++++lsPkv++vveqe++hn++ +++rf+eal+yysa+fdsle++lp++s er ++E+ l+g++i n+vaceg+er+erhe+l++W +r+ eaGF MA_959414g0010 1 MLRGLSPKVMIVVEQESNHNGGHLMDRFVEALYYYSAMFDSLESTLPQQSIERLTLEKYLFGKQIHNIVACEGSERVERHEKLQRWMKRFVEAGF 95 5899******************************************************************************************* PP GRAS 325 kpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 ++pl+++++ a++ll++++ d yr+ +++g+l+++W++rpL+svSaW+ MA_959414g0010 96 AQLPLGYTTVRHANRLLHTYS-DSYRLLQDRGCLTICWEERPLYSVSAWQ 144 ********************9.66*************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03514 | 2.0E-53 | 1 | 144 | IPR005202 | Transcription factor GRAS |
PROSITE profile | PS50985 | 27.019 | 1 | 125 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MLRGLSPKVM IVVEQESNHN GGHLMDRFVE ALYYYSAMFD SLESTLPQQS IERLTLEKYL 60 FGKQIHNIVA CEGSERVERH EKLQRWMKRF VEAGFAQLPL GYTTVRHANR LLHTYSDSYR 120 LLQDRGCLTI CWEERPLYSV SAWQSA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3g_A | 1e-25 | 1 | 143 | 237 | 378 | Protein SCARECROW |
5b3h_A | 9e-26 | 1 | 143 | 236 | 377 | Protein SCARECROW |
5b3h_D | 9e-26 | 1 | 143 | 236 | 377 | Protein SCARECROW |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024389853.1 | 8e-60 | scarecrow-like protein 3 | ||||
Refseq | XP_024389854.1 | 8e-60 | scarecrow-like protein 3 | ||||
Refseq | XP_024389855.1 | 8e-60 | scarecrow-like protein 3 | ||||
Refseq | XP_024389856.1 | 8e-60 | scarecrow-like protein 3 | ||||
Refseq | XP_024389857.1 | 8e-60 | scarecrow-like protein 3 | ||||
Swissprot | Q9LPR8 | 2e-51 | SCL3_ARATH; Scarecrow-like protein 3 | ||||
TrEMBL | A0A2K1JV70 | 2e-58 | A0A2K1JV70_PHYPA; Uncharacterized protein | ||||
TrEMBL | A9SHQ0 | 2e-58 | A9SHQ0_PHYPA; GRS2 GRAS-type E3 ubiquitin ligase protein | ||||
STRING | PP1S80_27V6.1 | 3e-59 | (Physcomitrella patens) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP2564 | 14 | 33 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G50420.1 | 7e-54 | scarecrow-like 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|