PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MA_9310518g0010

Organism

Picea abies

Taxonomic ID

3329

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

M-type_MADS

Protein Properties

Length: 67aa MW: 7685.89 Da PI: 10.1858

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MA_9310518g0010	genome	ConGenIE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.9	1e-31	9	57	1	49
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 krien++nrqvtfskRrng+lKKA+ELSvLC+aevavi+fss gklye+ MA_9310518g0010 9 KRIENTTNRQVTFSKRRNGLLKKAYELSVLCEAEVAVIVFSSGGKLYEF 57 79**********************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.912	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.7E-41	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.06E-31	2	64	IPR002100	Transcription factor, MADS-box
CDD	cd00265	6.19E-39	2	65	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-32	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.6E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 67 aa Download sequence Send to blast
MGRGKVEIKR IENTTNRQVT FSKRRNGLLK KAYELSVLCE AEVAVIVFSS GGKLYEFGNK 60 RYDEIPF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	2e-21	1	65	1	65	MEF2 CHIMERA
6byy_B	2e-21	1	65	1	65	MEF2 CHIMERA
6byy_C	2e-21	1	65	1	65	MEF2 CHIMERA
6byy_D	2e-21	1	65	1	65	MEF2 CHIMERA
6bz1_A	2e-21	1	65	1	65	MEF2 CHIMERA
6bz1_B	2e-21	1	65	1	65	MEF2 CHIMERA
6bz1_C	2e-21	1	65	1	65	MEF2 CHIMERA
6bz1_D	2e-21	1	65	1	65	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269\|PubMed:11828031, ECO:0000269\|PubMed:16326928, ECO:0000269\|PubMed:9869408}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007146364.1	4e-31	hypothetical protein PHAVU_006G034400g
Refseq	XP_027340650.1	5e-31	agamous-like MADS-box protein AGL1 isoform X2
Swissprot	Q40704	9e-31	MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBL	A0A287KI36	1e-31	A0A287KI36_HORVV; Uncharacterized protein
STRING	cassava4.1_021909m	1e-32	(Manihot esculenta)
STRING	Traes_3B_87AC5133F.2	3e-32	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G58780.2	6e-33	MIKC_MADS family protein

Publications ? help Back to Top
Kyozuka J,Shimamoto K Ectopic expression of OsMADS3, a rice ortholog of AGAMOUS, caused a homeotic transformation of lodicules to stamens in transgenic rice plants. Plant Cell Physiol., 2002. 43(1): p. 130-5 [PMID:11828031] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]