PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_9135269g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 100aa MW: 10832 Da PI: 3.6315 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 37.7 | 5.9e-12 | 2 | 51 | 49 | 98 |
DUF260 49 lpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 lp e+ +a++s++yeA ar++dP G++g+i++lq q++ l++++ +++ MA_9135269g0010 2 LPSEQGLEAINSMAYEASARLEDPAFGCTGIIQQLQLQISDLESQIIVTQ 51 56788889**********************************99987776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 9.948 | 1 | 54 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.5E-10 | 2 | 51 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
DLPSEQGLEA INSMAYEASA RLEDPAFGCT GIIQQLQLQI SDLESQIIVT QAVIQKIRSQ 60 QAQLVASIPG FSNKFNPTIS TSVNDADEEG EDLFNSSLMD |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT116525 | 1e-116 | BT116525.1 Picea glauca clone GQ03801_F09 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022743269.1 | 1e-15 | LOB domain-containing protein 1-like | ||||
TrEMBL | A9P1U3 | 8e-39 | A9P1U3_PICSI; Uncharacterized protein | ||||
STRING | XP_008783779.1 | 7e-15 | (Phoenix dactylifera) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G07900.1 | 3e-08 | LOB domain-containing protein 1 |