PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_903853g0010 | ||||||||
Common Name | HAP3A | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 179aa MW: 20401.8 Da PI: 5.1085 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 175.1 | 7.1e-55 | 25 | 121 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdrf+Pianv+rim+kvlP++akis+daket+qecvse+isf+tsea+++cqre+rkti+++d+lwa+ +lGf+dyvepl++yl+kyre+eg MA_903853g0010 25 VREQDRFMPIANVIRIMRKVLPTHAKISDDAKETIQECVSEYISFITSEANERCQREQRKTITAEDVLWAMNKLGFDDYVEPLTLYLQKYREIEG 119 69********************************************************************************************9 PP NF-YB 96 ek 97 ++ MA_903853g0010 120 DH 121 96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.8E-52 | 20 | 128 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 7.92E-40 | 28 | 128 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.6E-26 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.2E-18 | 59 | 77 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.2E-18 | 78 | 96 | No hit | No description |
PRINTS | PR00615 | 1.2E-18 | 97 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0033613 | Molecular Function | activating transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MSEVGSPTSQ DSRNSEDVDR ENCAVREQDR FMPIANVIRI MRKVLPTHAK ISDDAKETIQ 60 ECVSEYISFI TSEANERCQR EQRKTITAED VLWAMNKLGF DDYVEPLTLY LQKYREIEGD 120 HRGSIRGEPL PKKEMSALAN LSAGFQMSHP SLYGTSGMGY YKDSVASSNI NYDPYAHYK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-59 | 24 | 116 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF280794 | 0.0 | JF280794.1 Picea abies CCAAT-box binding factor HAP3-like protein (HAP3A) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006857806.2 | 8e-82 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | Q84W66 | 4e-62 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | F6LIE1 | 1e-132 | F6LIE1_PICAB; CCAAT-box binding factor HAP3-like protein | ||||
STRING | ERN19273 | 2e-82 | (Amborella trichopoda) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 1e-64 | nuclear factor Y, subunit B6 |