PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MA_859316g0010

Organism

Picea abies

Taxonomic ID

3329

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

MYB

Protein Properties

Length: 177aa MW: 20204 Da PI: 10.8615

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MA_859316g0010	genome	ConGenIE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	46.8	6.6e-15	20	66	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+WT+ Ed +l d+++ +G g W+ +++ g++R++k+c++rw +y MA_859316g0010 20 RGAWTKTEDMILSDYIRIHGDGEWRNLPQKAGLRRCGKSCRLRWMNY 66 89********************************************9 PP
2	Myb_DNA-binding	37.3	6.3e-12	80	114	8	44
HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 E++l+v+++++lG++ W++Ia +++ gRt++++k++ MA_859316g0010 80 EEDLIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYS 114 99***********.*****.*******95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.6E-19	15	69	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.74	15	71	IPR017930	Myb domain
SuperFamily	SSF46689	1.33E-25	17	113	IPR009057	Homeodomain-like
SMART	SM00717	1.3E-10	19	69	IPR001005	SANT/Myb domain
Pfam	PF00249	6.3E-13	20	66	IPR001005	SANT/Myb domain
CDD	cd00167	1.17E-8	22	67	No hit	No description
Gene3D	G3DSA:1.10.10.60	9.3E-19	70	122	IPR009057	Homeodomain-like
SMART	SM00717	1.4E-6	72	120	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	12.329	72	122	IPR017930	Myb domain
CDD	cd00167	4.67E-8	80	113	No hit	No description
Pfam	PF00249	4.2E-10	80	115	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 177 aa Download sequence Send to blast
SQPRSLDQNG GYGSKQGLNR GAWTKTEDMI LSDYIRIHGD GEWRNLPQKA GLRRCGKSCR 60 LRWMNYIRPD IKLGNIFPYE EDLIVRLHRL LGNRWSLIAG RLPGRTDNEI KNYSNTRLSK 120 KLPPTNDSEP NSSTQNLKTG SKFLSVVHDH VLKTTPVKTK VVRYSEMVRP NRSKGSG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-21	18	122	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT109486	0.0	BT109486.1 Picea glauca clone GQ03209_A18 mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017982182.1	4e-62	PREDICTED: myb-related protein Myb4
Refseq	XP_019102913.1	2e-62	PREDICTED: transcription factor MYB23
Swissprot	P10290	7e-52	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	F8TJT0	7e-74	F8TJT0_PINRE; MYB-like protein (Fragment)
STRING	XP_010666251.1	7e-62	(Beta vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G35550.1	1e-53	MYB family protein

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]